Apolipoprotein E/APOE Protein, Rabbit (His-SUMO)
Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
- Species: Rabbit
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
Background
APOE is a protein that plays a crucial role in the transport of lipids between organs through plasma and interstitial fluids. It is a key component of various lipoproteins, including chylomicrons, VLDL, IDL, and HDL. APOE binds to a wide range of cellular receptors, such as LDLR and VLDLR, facilitating the uptake of lipoprotein particles. Additionally, APOE has a heparin-binding activity and interacts with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and uptake of lipoproteins. It forms a homotetramer and can interact with ABCA1 in the formation of HDLs. APOE may also interact with other proteins like APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.
Technical Parameters
-
Species Rabbit
-
Source E. coli
-
Tag N-10*His;N-SUMO
-
Accession
P18287 (T20-Q311)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
APOE (T20-Q311)
Accession # P18287 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5
-
AA Sequence
TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
-
Predicted Molecular Mass
53.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
