ARC Protein, Human
Based on 1 Customer Validation
ARC Protein, Human that exists in monomeric, oligomeric forms and is capable of reversible self-oligomerization. ARC Protein is a master regulator of long-term synaptic plasticity and memory.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ARC Protein, Human that exists in monomeric, oligomeric forms and is capable of reversible self-oligomerization. ARC Protein is a master regulator of long-term synaptic plasticity and memory[1].
Background
Recombinant Human ARC (hArc) appears to be pyramid-shaped as a monomer and is capable of reversible self-association, forming large soluble oligomers. The N-terminal domain of Recombinant Human ARC is highly basic, which may promote interaction with cytoskeletal structures or other polyanionic surfaces, whereas the C-terminal domain is acidic and stabilized by ionic conditions that promote oligomerization[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O60936 (M1-S208)
-
Molecular Construction
-
N-term
-
ARC (M1-S208)
Accession # O60936 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NOL3; Nucleolar Protein Of 30 KDa; Nucleolar Protein 3; CARD2; ARC; NOP; NOP30; MYOCL1; MYP; Nop30; Nucleolar Protein 3 (Apoptosis Repressor With CARD Domain); FCM; Muscle-Enriched Cytoplasmic Protein; Myp; Apoptosis Repressor With CARD
-
AA Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
-
Predicted Molecular Mass
22.6 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 2 mM β-ME, 20% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)