ARC Protein, Human

ARC Protein, Human that exists in monomeric, oligomeric forms and is capable of reversible self-oligomerization. ARC Protein is a master regulator of long-term synaptic plasticity and memory^[1].

Recombinant Human ARC (hArc) appears to be pyramid-shaped as a monomer and is capable of reversible self-association, forming large soluble oligomers. The N-terminal domain of Recombinant Human ARC is highly basic, which may promote interaction with cytoskeletal structures or other polyanionic surfaces, whereas the C-terminal domain is acidic and stabilized by ionic conditions that promote oligomerization^[1].

Human

E. coli

Tag Free

O60936 (M1-S208)

8996  [NCBI]

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 2 mM β-ME, 20% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Craig Myrum, et al. Arc Is a Flexible Modular Protein Capable of Reversible Self-Oligomerization. Biochem J. 2015 May 15;468(1):145-58.  [Content Brief]