ASF1B Protein, Human (sf9, His)

The ASF1B protein is an important histone chaperone that crucially promotes histone deposition and coordinates exchange and removal during nucleosome assembly and disassembly, which has been verified by various studies. ASF1B cooperates with CAF-1 to promote replication-dependent chromatin assembly. ASF1B Protein, Human (sf9, His) is the recombinant human-derived ASF1B protein, expressed by Sf9 insect cells , with C-His labeled tag.

ASF1B Protein, a key histone chaperone, plays a crucial role in facilitating histone deposition and orchestrating histone exchange and removal during nucleosome assembly and disassembly, as evidenced by various studies. Collaborating with chromatin assembly factor 1 (CAF-1), ASF1B contributes to the promotion of replication-dependent chromatin assembly. Additionally, ASF1B is involved in the nuclear import of the histone H3-H4 dimer alongside importin-4 (IPO4), displaying a specific recognition and binding affinity for newly synthesized histones marked with H3K9me1 and H4K5K12ac in the cytosol. Notably, ASF1B does not participate in replication-independent nucleosome deposition, a process mediated by ASF1A and HIRA. Beyond its role in chromatin dynamics, ASF1B is required for gonad development. Interactions with histone H3 (including both H3.1 and H3.3) and histone H4, as well as with partner proteins such as CHAF1A, CHAF1B, RBBP4, HAT1, NASP, TAF1, CDAN1, IPO4, and CREBBP, further highlight the multifaceted functions of ASF1B in cellular processes. ASF1B is also found in a cytosolic complex with IPO4 and histones H3 and H4.

Human

Sf9 insect cells

C-His

Q9NVP2 (M1-I202)

55723  [NCBI]

Full Length

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

Approximately 20 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.