ASF1B Protein, Human (sf9, His)

The ASF1B protein is an important histone chaperone that crucially promotes histone deposition and coordinates exchange and removal during nucleosome assembly and disassembly, which has been verified by various studies. ASF1B cooperates with CAF-1 to promote replication-dependent chromatin assembly. ASF1B Protein, Human (sf9, His) is the recombinant human-derived ASF1B protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ASF1B protein is an important histone chaperone that crucially promotes histone deposition and coordinates exchange and removal during nucleosome assembly and disassembly, which has been verified by various studies. ASF1B cooperates with CAF-1 to promote replication-dependent chromatin assembly. ASF1B Protein, Human (sf9, His) is the recombinant human-derived ASF1B protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

ASF1B Protein, a key histone chaperone, plays a crucial role in facilitating histone deposition and orchestrating histone exchange and removal during nucleosome assembly and disassembly, as evidenced by various studies. Collaborating with chromatin assembly factor 1 (CAF-1), ASF1B contributes to the promotion of replication-dependent chromatin assembly. Additionally, ASF1B is involved in the nuclear import of the histone H3-H4 dimer alongside importin-4 (IPO4), displaying a specific recognition and binding affinity for newly synthesized histones marked with H3K9me1 and H4K5K12ac in the cytosol. Notably, ASF1B does not participate in replication-independent nucleosome deposition, a process mediated by ASF1A and HIRA. Beyond its role in chromatin dynamics, ASF1B is required for gonad development. Interactions with histone H3 (including both H3.1 and H3.3) and histone H4, as well as with partner proteins such as CHAF1A, CHAF1B, RBBP4, HAT1, NASP, TAF1, CDAN1, IPO4, and CREBBP, further highlight the multifaceted functions of ASF1B in cellular processes. ASF1B is also found in a cytosolic complex with IPO4 and histones H3 and H4.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ASF1B (M1-I202)
      Accession # Q9NVP2
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ASF1B; HCIA-II; Anti-Silencing Function 1B Histone Chaperone; CIA-II; Anti-Silencing Function Protein 1 Homolog B; HAsf1b; CCG1-Interacting Factor A-II; HAsf1; Histone Chaperone ASF1B; ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae); FLJ10604; AS

  • AA Sequence

    MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

  • Predicted Molecular Mass

    23.9 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00