ASXL1 Protein, Human (GST)
Based on 1 Customer Validation
ASXL1 Protein, Human (GST) is a recombinant human Additional Sex Combs-like Protein 1 (ASXL1) expressed in E. coli with a GST tag. ASXLs make biological and functional roles in development, cancer, and transcription.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ASXL1 Protein, Human (GST) is a recombinant human Additional Sex Combs-like Protein 1 (ASXL1) expressed in E. coli with a GST tag. ASXLs make biological and functional roles in development, cancer, and transcription[1].
Background
Additional sex combs-like (ASXL) proteins are mammalian homologs of Addition of sex combs (Asx), a protein that regulates the balance of trithorax and Polycomb function in Drosophila. All three ASXL family members (ASXL1, ASXL2, and ASXL3) are affected by somatic or de novo germline mutations in cancer or rare developmental syndromes, respectively[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q8IXJ9-1 (K1477-R1541)
-
Molecular Construction
-
N-term
-
GST
-
ASXL1 (K1477-R1541)
Accession # Q8IXJ9-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ASXL1; Putative Polycomb Group Protein ASXL1; ASXL Transcriptional Regulator 1; Additional Sex Combs-Like Protein 1; KIAA0978; Polycomb Group Protein; Additional Sex Combs Like 1, Transcriptional Regulator; ASXL1 Protein; Polycomb Group Protein ASXL1; ASX
-
AA Sequence
KANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR
-
Predicted Molecular Mass
33.6 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
