1. Recombinant Proteins
  2. ASXL1 Protein, Human (GST)

ASXL1 Protein, Human (GST)

Cat. No.: HY-P7614
Handling Instructions

ASXL1 Protein, Human (GST) is a recombinant human Additional Sex Combs-like Protein 1 (ASXL1) expressed in E. coli with a GST tag. ASXLs make biological and functional roles in development, cancer, and transcription[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuASXL1, N-GST; Putative Polycomb group protein ASXL1; Additional sex combs-like protein 1; ASXL1; KIAA0978
Species

Human

Source

E. coli

Accession

Q8IXJ9 (K1477-R1541)

Gene ID

171023

Molecular Weight

Approximately 38.0 kDa

AA Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Additional sex combs-like (ASXL) proteins are mammalian homologs of Addition of sex combs (Asx), a protein that regulates the balance of trithorax and Polycomb function in Drosophila. All three ASXL family members (ASXL1, ASXL2, and ASXL3) are affected by somatic or de novo germline mutations in cancer or rare developmental syndromes, respectively[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASXL1 Protein, Human (GST)
Cat. No.:
HY-P7614
Quantity:
MCE Japan Authorized Agent: