ATP5D Protein, Human (His-SUMO)
ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His-SUMO) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATP5D Protein, a vital component of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. As part of the F(1) domain and central stalk, ATP5D contributes to ATP hydrolysis through a rotary mechanism. The ATP synthase complex, involving ATP5D, is pivotal for cellular energy production via ATP synthesis. ATP5D Protein, Human (His-SUMO) is the recombinant human-derived ATP5D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
The ATP5D protein functions as a crucial component of the mitochondrial membrane ATP synthase, also known as Complex V. This enzyme is responsible for generating ATP from ADP by utilizing the proton gradient across the mitochondrial membrane, a gradient established by the electron transport complexes of the respiratory chain. The F-type ATPases, to which ATP5D belongs, consist of two main structural domains: F(1), housing the catalytic core, and F(0), housing the membrane proton channel. During catalysis, ATP turnover in the F(1) catalytic domain is linked to proton translocation through a rotary mechanism involving the central stalk subunits. ATP5D is part of both the F(1) domain and the central stalk, contributing to the rotation that leads to ATP hydrolysis. The ATP synthase complex, in which ATP5D participates, includes various subunits and plays a pivotal role in cellular energy production through ATP synthesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P30049 (A23-E168)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
ATP5D (A23-E168)
Accession # P30049 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ATP5F1D; F-ATPase Delta Subunit; Prev. ATP5D; ATP Synthase Subunit Delta, Mitochondrial; ATP Synthase F(1) Complex Subunit Delta, Mitochondrial; Mitochondrial ATP Synthase, Delta Subunit; ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Delta Subu
-
AA Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
-
Predicted Molecular Mass
31 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
