Copy Link Print Information

B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Beta-2 microglobulin protein (B2M) is crucial in presenting antigens, aiding immune surveillance.B2M forms a complex with an alpha chain, creating MHC class I molecules for antigen recognition.It also participates in a heterotrimer with MR1, expanding its role in antigen presentation and immune signaling pathways.B2M's intricate interactions underscore its significance in orchestrating immune responses.B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)
  • Experimental Validation Results for B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)
  • B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Beta-2 microglobulin protein (B2M) is crucial in presenting antigens, aiding immune surveillance.B2M forms a complex with an alpha chain, creating MHC class I molecules for antigen recognition.It also participates in a heterotrimer with MR1, expanding its role in antigen presentation and immune signaling pathways.B2M's intricate interactions underscore its significance in orchestrating immune responses.B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Background

As a crucial component of the class I major histocompatibility complex (MHC), Beta-2 microglobulin (B2M) plays a pivotal role in presenting peptide antigens to the immune system, contributing to immune surveillance and response. Operating within a heterodimeric structure, B2M forms a complex with an alpha chain to create major histocompatibility complex class I molecules, facilitating the recognition of antigens by immune cells. Notably, B2M functions as the beta-chain in this molecular arrangement. Furthermore, it engages in the formation of a heterotrimer with MR1 and a metabolite antigen, expanding its involvement in antigen presentation and immune signaling pathways. The intricate interactions and molecular partnerships underscore the significance of B2M in the orchestration of immune responses through the recognition and presentation of antigens.

Verified Bioactivity

Measured by its ability to promote the proliferation of U251 human glioma cell. The ED50  for this effect is 58.88 ng/mL, corresponding to a specific activity is 1.7×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to promote the proliferation of U251 human glioma cell. The ED50 for this effect is 58.88 ng/mL, corresponding to a specific activity is 1.7×104 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    P07151 (I21-M119)

  • Gene ID
    24223  [NCBI]
  • Molecular Construction
    • N-term
    • B2M (M1-M119)
      Accession # P07151
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    B2M; Beta 2-Microglobulin; Beta-2-Microglobulin; Beta-2-Microglobin; Beta Chain Of MHC Class I Molecules; AMYLD6; Beta 2-Microglobulin Protein; MHC1D4; Human Nkt Tcr Alpha Chain; IMD43; Human Nkt Tcr Beta Chain

  • AA Sequence

    IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to promote the proliferation of U251 human glioma cell. The ED50 for this effect is 58.88 ng/mL, corresponding to a specific activity is 1.7×104 units/mg.

  • B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)
  • Experimental Validation Results for B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)
  • B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) Product Image