B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution)

Beta-2 microglobulin protein (B2M) is crucial in presenting antigens, aiding immune surveillance.B2M forms a complex with an alpha chain, creating MHC class I molecules for antigen recognition.It also participates in a heterotrimer with MR1, expanding its role in antigen presentation and immune signaling pathways.B2M's intricate interactions underscore its significance in orchestrating immune responses.B2M/Beta-2 microglobulin Protein, Rat (HEK293, His, solution) is the recombinant rat-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

As a crucial component of the class I major histocompatibility complex (MHC), Beta-2 microglobulin (B2M) plays a pivotal role in presenting peptide antigens to the immune system, contributing to immune surveillance and response. Operating within a heterodimeric structure, B2M forms a complex with an alpha chain to create major histocompatibility complex class I molecules, facilitating the recognition of antigens by immune cells. Notably, B2M functions as the beta-chain in this molecular arrangement. Furthermore, it engages in the formation of a heterotrimer with MR1 and a metabolite antigen, expanding its involvement in antigen presentation and immune signaling pathways. The intricate interactions and molecular partnerships underscore the significance of B2M in the orchestration of immune responses through the recognition and presentation of antigens.

Measured by its ability to promote the proliferation of U251 human glioma cell. The ED₅₀  for this effect is 58.88 ng/mL, corresponding to a specific activity is 1.7×10⁴ units/mg.

• 
  Measured by its ability to promote the proliferation of U251 human glioma cell. The ED₅₀ for this effect is 58.88 ng/mL, corresponding to a specific activity is 1.7×10⁴ units/mg.

Rat

HEK293

C-His

P07151 (I21-M119)

24223  [NCBI]

Full Length of Mature Protein

IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Approximately 15 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.