B3GALT5 Protein, Human (sf9, His)

B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (sf9, His) is the recombinant human-derived B3GALT5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Beta-1,3-Galactosyltransferase 5 (B3GALT5) is an enzyme that plays a key role in glycosylation by catalyzing the transfer of a galactose (Gal) residue to GlcNAc-based acceptors. This enzyme exhibits a preference for the core3 O-linked glycan structure, specifically GlcNAc(beta1,3)GalNAc. Additionally, B3GALT5 demonstrates efficiency in using glycolipid LC3Cer as an acceptor substrate. The transfer of galactose by B3GALT5 is integral to the biosynthesis of complex glycan structures, contributing to the diversity of glycoconjugates involved in cellular recognition, signaling, and adhesion processes. Understanding the substrate specificity of B3GALT5 provides insights into its role in glycosylation pathways and the modulation of cellular functions through the generation of specific glycan structures.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

N-His

Q9Y2C3 (N29-V310)

10317  [NCBI]

Lumenal Domain

NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV

35.2 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.