Copy Link Print Information

B3GALT5 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (sf9, His) is the recombinant human-derived B3GALT5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • B3GALT5 Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (sf9, His) is the recombinant human-derived B3GALT5 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Beta-1,3-Galactosyltransferase 5 (B3GALT5) is an enzyme that plays a key role in glycosylation by catalyzing the transfer of a galactose (Gal) residue to GlcNAc-based acceptors. This enzyme exhibits a preference for the core3 O-linked glycan structure, specifically GlcNAc(beta1,3)GalNAc. Additionally, B3GALT5 demonstrates efficiency in using glycolipid LC3Cer as an acceptor substrate. The transfer of galactose by B3GALT5 is integral to the biosynthesis of complex glycan structures, contributing to the diversity of glycoconjugates involved in cellular recognition, signaling, and adhesion processes. Understanding the substrate specificity of B3GALT5 provides insights into its role in glycosylation pathways and the modulation of cellular functions through the generation of specific glycan structures.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His
  • Accession

    Q9Y2C3 (N29-V310)

  • Gene ID
    10317  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • B3GALT5 (N29-V310)
      Accession # Q9Y2C3
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    B3GALT5; Beta-1,3-GalTase 5; Beta-1,3-Galactosyltransferase 5; Beta-3-Gx-T5; Beta3Gal-T5; UDP-Gal:Beta-GlcNAc Beta-1,3-Galactosyltransferase 5; B3GalT-V; UDP-Gal:BetaGlcNAc Beta 1,3-Galactosyltransferase 5; GLCT5; GlcNAc-Beta-1,3-Galactosyltransferase 5;

  • AA Sequence

    NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV

  • Predicted Molecular Mass

    35.2 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • B3GALT5 Protein, Human (sf9, His) Product Image
    1/16
  • B3GALT5 Protein, Human (sf9, His) Product Image