1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. B4GALT1 Protein, Human (HEK293, Y285L, His)

B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway[1][2].

Background

B4GALT1 expression is identified as an independent adverse prognostic factor for survival in non-metastatic clear cell renal cell carcinoma modesl[1]. B4GALT1 gene plays important roles in physiological process and disease development. B4GALT1 is shown to be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids [2]. B4GALT1 is a new candidate to maintain the Stemness of lung Cancer stem cells[3].

Biological Activity

Measured by its ability to transfer N-Acetyl-D-galactosamine from UDP-GalNAc to N-Acetyl-D-glucosamine that incubate at 37°C for 20 min. The specific activity is >400 pmol/min/μg.

Assay Procedure

Materials
Assay buffer: 50 mM HEPES, 10 mM MnCl2, pH 7.5
B4GALT1 Protein, Human (HEK293, Y285L, His) (HY-P7628)
Substrates: UDP-GalNAc (HY-112174), N-Acetyl-alpha-D-glucosamine (GlcNAc, HY-A0132)
Glycosyltransferase Activity Kit

Procedure
1. Dilute UDP-GalNAc to 1 mM with assay buffer.
2. Dilute Coupled Phosphatase 1 to 20 μg/mL with assay buffer.
3. Dilute GlcNAc to 200 mM with assay buffer.
4. Prepare the reaction mixture by mixing equal volumes of 1 mM UDP-GalNAc, 20 μg/mL Coupled Phosphatase 1, and 200 mM GlcNAc.
5. Dilute Human B4GalT1 to 1 μg/mL with assay buffer.
6. Add 40 μL of 1 mM phosphate standard to 360 μL of assay buffer to dilute the 1 mM phosphate standard provided in the Glycosyltransferase Activity Kit to obtain a 100 μM stock solution.
7. Prepare the standard curve by performing six 1:2 serial dilutions of the 100 μM phosphate stock solution in assay buffer. The standard curve range is 0.078 to 5 nmol/well.
8. Add 50 μL of different concentrations of the standard curve dilutions to a 96-well plate; add 50 μL of assay buffer to the blank group.
9. Add 20 μL of 1 μg/mL Human B4GalT1 to the 96-well plate; add 20 μL of assay buffer to the blank group.
10. Add 30 μL of the reaction mixture to the wells, excluding the standard curve wells and blank wells.
11. Incubate at 37 °C for 15 minutes.
12. Add 30 μL of Malachite Green Reagent A to all wells and mix.
13. Add 100 μL of deionized water to all wells and mix.
14. Add 30 μL of Malachite Green Reagent B to all wells, mix, and incubate at room temperature for 20 minutes.
15. Read the plate at 620 nm (absorbance) in endpoint mode.
16. Calculate Specific Activity:

     Specific Activity (pmol/min/μg) =

Phosphate released* (nmol) x (1000 pmol/nmol)
Incubation time (min) x amount of enzyme (μg)

*Derived from the phosphate standard curve using linear fitting and adjusted for Control.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P15291-1 (G44-S398, Y285L)

Gene ID
Molecular Construction
N-term
B4GALT1 (G44-S398, Y285L)
Accession # P15291-1
6*His
C-term
Protein Length

Lumenal Domain

Synonyms
rHuB4GALT1, His; B4GALT1; Beta-1,4-GalTase 1; CDG2D
AA Sequence

GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQLFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

Predicted Molecular Mass
40.1 kDa
Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Supplied as a 0.22 μm filter solution of 20mM Tris-HCl, 150mM NaCl, 2mM EDTA, 20% Glycerol, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

B4GALT1 Protein, Human (HEK293, Y285L, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

B4GALT1 Protein, Human (HEK293, Y285L, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B4GALT1 Protein, Human (HEK293, Y285L, His)
Cat. No.:
HY-P7628
Quantity:
MCE Japan Authorized Agent: