BAFF/TNFSF13B Protein, Human (His-SUMO)
BAFF/TNFSF13B protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a key ligand-receptor pathway together with TNFSF13/APRIL. These interactions play a crucial role in stimulating B-cell and T-cell function and regulating humoral immunity. BAFF/TNFSF13B Protein, Human (His-SUMO) is the recombinant human-derived BAFF/TNFSF13B protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BAFF/TNFSF13B protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a key ligand-receptor pathway together with TNFSF13/APRIL. These interactions play a crucial role in stimulating B-cell and T-cell function and regulating humoral immunity. BAFF/TNFSF13B Protein, Human (His-SUMO) is the recombinant human-derived BAFF/TNFSF13B protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
BAFF/TNFSF13B protein, a cytokine, binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a key ligand-receptor pathway alongside TNFSF13/APRIL. Together, these interactions play a crucial role in stimulating B- and T-cell function and regulating humoral immunity. Notably, a third B-cell-specific receptor, BAFFR/BR3, is involved in promoting the survival of mature B-cells and facilitating the B-cell response. This intricate network underscores the significance of BAFF/TNFSF13B in orchestrating immune responses. Additionally, isoform 2 of BAFF/TNFSF13B appears to exert a regulatory role by inhibiting the secretion and bioactivity of isoform 1. The dynamic interplay between these isoforms further contributes to the nuanced control of BAFF/TNFSF13B-mediated immune processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q9Y275-1 (Q68-L285)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
BAFF (Q68-L285)
Accession # Q9Y275-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis
-
AA Sequence
QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
-
Predicted Molecular Mass
39.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
