1. Recombinant Proteins
  2. Others
  3. BCL2L12 Protein, Human (GST)

BCL2-like 12 (BCL2L12) is a new member of the apoptosis-related BCL2 gene family. BCL2L12 contains a highly conserved BH2 domain, a BH3-like domain and a proline-rich region. BCL2L12 exhibits pro-apoptotic activity in breast tumor and gastric cancer. BCL2L12 is an inhibitor of post-mitochondrial effector caspase activation, as it binds to and inhibits caspase-7 and upregulates the caspase-3-specific inhibitor 伪B-crystallin (CRYAB). BCL2L12 attenuates endogenous p53-directed transcriptomic changes after genotoxic stress and inhibits p53-dependent DNA damage-induced apoptosis. BCL2L12 Protein, Human (GST) is the recombinant human-derived BCL2L12 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BCL2-like 12 (BCL2L12) is a new member of the apoptosis-related BCL2 gene family. BCL2L12 contains a highly conserved BH2 domain, a BH3-like domain and a proline-rich region. BCL2L12 exhibits pro-apoptotic activity in breast tumor and gastric cancer. BCL2L12 is an inhibitor of post-mitochondrial effector caspase activation, as it binds to and inhibits caspase-7 and upregulates the caspase-3-specific inhibitor 伪B-crystallin (CRYAB). BCL2L12 attenuates endogenous p53-directed transcriptomic changes after genotoxic stress and inhibits p53-dependent DNA damage-induced apoptosis[1][2]. BCL2L12 Protein, Human (GST) is the recombinant human-derived BCL2L12 protein, expressed by E. coli , with N-GST labeled tag.

Background

Currently, two functional splicing variants of the Bcl2L12 gene are known: one consisting of seven coding exons and producing a 334-amino acid protein with a molecular mass of 36.8 kDa and another one resulting from alternative splicing and giving rise to a protein of 176 amino acids, a splice variant called Bcl2L12A which lacks exon 3 (143 bp). Bcl2L12 interacts with Bcl-xL and Bcl2 in yeast two-hybrid system. Bcl2L12192-220 was a minimal region for Bcl2L12-Bcl-xL interaction. both h1 (L213) and h2 residue (L217) are essential for Bcl2L12 interacting with Bcl2 family proteins[1].

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9HB09-1 (P64-K143)

Gene ID
Molecular Construction
N-term
GST
BCL2L12 (P64-K143)
Accession # Q9HB09-1
C-term
Protein Length

Partial

Synonyms
Bcl-2-like protein 12; Bcl2-L-12; Bcl-2-related proline-rich protein; BPR
AA Sequence

PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK

Predicted Molecular Mass
36 kDa
Molecular Weight

Approximately 33 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BCL2L12 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BCL2L12 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCL2L12 Protein, Human (GST)
Cat. No.:
HY-P76165
Quantity:
MCE Japan Authorized Agent: