BCL2L12 Protein, Human (GST)
BCL2-like 12 (BCL2L12) is a new member of the apoptosis-related BCL2 gene family. BCL2L12 contains a highly conserved BH2 domain, a BH3-like domain and a proline-rich region. BCL2L12 exhibits pro-apoptotic activity in breast tumor and gastric cancer. BCL2L12 is an inhibitor of post-mitochondrial effector caspase activation, as it binds to and inhibits caspase-7 and upregulates the caspase-3-specific inhibitor 伪B-crystallin (CRYAB). BCL2L12 attenuates endogenous p53-directed transcriptomic changes after genotoxic stress and inhibits p53-dependent DNA damage-induced apoptosis. BCL2L12 Protein, Human (GST) is the recombinant human-derived BCL2L12 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
BCL2-like 12 (BCL2L12) is a new member of the apoptosis-related BCL2 gene family. BCL2L12 contains a highly conserved BH2 domain, a BH3-like domain and a proline-rich region. BCL2L12 exhibits pro-apoptotic activity in breast tumor and gastric cancer. BCL2L12 is an inhibitor of post-mitochondrial effector caspase activation, as it binds to and inhibits caspase-7 and upregulates the caspase-3-specific inhibitor 伪B-crystallin (CRYAB). BCL2L12 attenuates endogenous p53-directed transcriptomic changes after genotoxic stress and inhibits p53-dependent DNA damage-induced apoptosis[1][2]. BCL2L12 Protein, Human (GST) is the recombinant human-derived BCL2L12 protein, expressed by E. coli , with N-GST labeled tag.
Currently, two functional splicing variants of the Bcl2L12 gene are known: one consisting of seven coding exons and producing a 334-amino acid protein with a molecular mass of 36.8 kDa and another one resulting from alternative splicing and giving rise to a protein of 176 amino acids, a splice variant called Bcl2L12A which lacks exon 3 (143 bp). Bcl2L12 interacts with Bcl-xL and Bcl2 in yeast two-hybrid system. Bcl2L12192-220 was a minimal region for Bcl2L12-Bcl-xL interaction. both h1 (L213) and h2 residue (L217) are essential for Bcl2L12 interacting with Bcl2 family proteins[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9HB09-1 (P64-K143)
-
Molecular Construction
-
N-term
-
GST
-
BCL2L12 (P64-K143)
Accession # Q9HB09-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BCL2L12; BCL-2-Like Protein 12 Isoform 14; BCL2 Like 12; BCL-2-Like Protein 12 Isoform 13; BCL2-Like 12 (Proline Rich); BCL-2-Like Protein 12 Isoform 11; Bcl-2-Like Protein 12; BCL-2-Like Protein 12 Isoform 10; BCL2-Like 12 (Proline Rich), Isoform CRA_c;
-
AA Sequence
PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
