BIN1 Protein, Human (His)
Based on 1 Customer Validation
The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.
The BIN1 Protein plays a crucial role in the regulation of plasma membrane curvature, shaping, and remodeling. In muscle cells, it is indispensable for the formation of T-tubules, which are tubular invaginations of the plasma membrane critical for depolarization-contraction coupling. Acting as a negative regulator of endocytosis, BIN1 is also involved in intracellular vesicle sorting and modulates BACE1 trafficking, influencing amyloid-beta production. In neuronal circuits, its role in endocytosis regulation may impact the internalization of PHF-tau aggregates. Furthermore, BIN1 is implicated in the regulation of MYC activity, influencing cell proliferation, and exhibits actin bundling activity, stabilizing actin filaments against depolymerization. BIN1 forms a heterodimer with AMPH, binds to SH3GLB1, interacts with DNM1, SYNJ1, DNM2, AP2A2, AP2B1, MYC, BIN2, SNX4, and BACE1, indicating its involvement in diverse cellular processes and protein-protein interactions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
O00499-10 (M1-P424)
-
Molecular Construction
-
N-term
-
His
-
BIN1 (M1-P424)
Accession # O00499-10 -
C-term
-
-
Protein Length
Full Length of Isoform-10
-
Synonyms
BIN1; AMPH2; Prev. AMPHL; Amphiphysin-Like Protein; Myc Box-Dependent-Interacting Protein 1; Amphiphysin 2; Amphiphysin II; Box Dependant MYC Interacting Protein 1; SH3P9; CNM2; Bridging Integrator 1; Box-Dependent Myc-Interacting Protein 1
-
AA Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0, 10% trehalose, 0.02% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
