BMPR-II Protein, Human (HEK293, His)
Based on 1 Customer Validation
BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.). BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis[1][2]. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes[3]. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.). BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.
Background
BMP Type II Receptor (BMPR2) is a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPs are involved in endochondral bone formation and embryogenesis, transducing signals through the formation of heteromeric complexes of 2 types BMP receptors: type I receptors (50-55 kD) and type II receptors (70-80 kD). Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators[1][2]. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis. The BMPR2 pathway inhibits smooth muscle cell (SMC) proliferation within the pulmonary circulation, primarily within the small pulmonary arterioles. When mutated, BMPR2 is associated with an increased susceptibility to develop pulmonary arterial hypertension (PAH)[1]. BMPR2 is essential for tubulin stability, as recent studies have shown that BMP2 regulates cell survival signaling events in cancer cells independent of the BMP type 1 receptor (BMPR1) or the Smad-1/5 transcription factor. Mutations in BMPR2 trafficking proteins leads to overactive BMP signaling, which leads to neurological diseases caused by BMPR2 stabilization of the microtubules. Inhibition of BMPR2 destabilizes the microtubules, thus leads to lysosomes activation in promoting cell death progress of cancer cells[3]. Particularly, there is strong correlation between BMPR2 promoter DNA methylation and the severity of valvular heart disease (VHD), which makes BMPR2 serve as good biomarkers of VHD. Meanwhile, DNA methylation may cause PAH through deregulation of BMP signaling and increased apoptosis[4]. The sequences of BMPR2 protein are conserved among different species, and the sequence of human shares a high similarity with rat (96.15%) and mouse (96.63%), respectively.
Verified Bioactivity
This product does not contain protein kinase domain.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q13873-1 (S27-I151)
-
Molecular Construction
-
N-term
-
BMPR-II (S27-I151)
Accession # Q13873-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BMPR2; Bone Morphogenetic Protein Receptor Type-2; Prev. PPH1; BMP Type-2 Receptor; BMPR-II; Type II Receptor For Bone Morphogenetic Protein-4; Bone Morphogenetic Protein Receptor Type II; Type II Activin Receptor-Like Kinase; BRK-3; Primary Pulmonary Hyp
-
AA Sequence
SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETI
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Xu B, et al. The role of TGF-β or BMPR2 signaling pathway-related miRNA in pulmonary arterial hypertension and systemic sclerosis. Arthritis Res Ther. 2021 Nov 25;23(1):288. [Content Brief]
[2]. Kim MJ, et al. Clinical significance linked to functional defects in bone morphogenetic protein type 2 receptor, BMPR2. BMB Rep. 2017;50(6):308-317. [Content Brief]
[3]. ten Dijke P, et al. Signaling via hetero-oligomeric complexes of type I and type II serine/threonine kinase receptors. Curr Opin Cell Biol. 1996 Apr;8(2):139-45. [Content Brief]
[4]. Mondal A, et al. Bone morphogenetic protein receptor 2 inhibition destabilizes microtubules promoting the activation of lysosomes and cell death of lung cancer cells. Cell Commun Signal. 2021 Sep 25;19(1):97. [Content Brief]
[5]. Li N, et al. BMPR2 promoter methylation and its expression in valvular heart disease complicated with pulmonary artery hypertension. Aging (Albany NY). 2021 Nov 18;13(22):24580-24604. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)