BMX Protein, Human (sf9, His)

BMX proteins are nonreceptor tyrosine kinases that centrally regulate various signaling pathways that control actin dynamics, migration, proliferation, and survival. BMX participates in signal transduction of multiple receptors such as integrins, growth factor receptors, and cytokine receptors, induces BCAR1 tyrosine phosphorylation, and plays a key role in TNF-induced angiogenesis. BMX Protein, Human (sf9, His) is the recombinant human-derived BMX protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BMX proteins are nonreceptor tyrosine kinases that centrally regulate various signaling pathways that control actin dynamics, migration, proliferation, and survival. BMX participates in signal transduction of multiple receptors such as integrins, growth factor receptors, and cytokine receptors, induces BCAR1 tyrosine phosphorylation, and plays a key role in TNF-induced angiogenesis. BMX Protein, Human (sf9, His) is the recombinant human-derived BMX protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

BMX Protein, a non-receptor tyrosine kinase, assumes central and diverse modulatory roles in various signaling pathways governing actin reorganization, cell migration, proliferation, survival, adhesion, and apoptosis. It actively participates in signal transduction initiated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors, and integrins. BMX induces tyrosine phosphorylation of BCAR1 in response to integrin regulation, facilitated by PTK2/FAK1, a pivotal mediator of integrin signaling events crucial for actin cytoskeleton regulation and cell motility. It plays a critical role in TNF-induced angiogenesis and is implicated in the signaling of TEK and FLT1 receptors, both essential for angiogenesis. BMX is indispensable for the phosphorylation and activation of STAT3, a transcription factor crucial in cell differentiation, and is involved in interleukin-6 (IL6) induced differentiation. Additionally, BMX plays a role in programming adaptive cytoprotection against extracellular stress in various cell systems, including salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. Its potential involvement in the regulation of endocytosis through interaction with the endosomal protein RUFY1 and its role in the growth and differentiation of hematopoietic cells further underscore its multifaceted functions. Additionally, BMX contributes to signal transduction in endocardial and arterial endothelial cells.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • BMX (E411-H675)
      Accession # P51813
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BMX; Cytoplasmic Tyrosine-Protein Kinase BMX; BMX Non-Receptor Tyrosine Kinase; BTK-Like On X Chromosome; ETK; Etk/Bmx Cytosolic Tyrosine Kinase; PSCTK3; NTK38 Tyrosine Kinase; Bone Marrow Tyrosine Kinase Gene In Chromosome X Protein; PSCTK2; Epithelial A

  • AA Sequence

    ELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00