1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Kinases
  3. TGF-beta Superfamily Cytokine Receptors Transferases (EC 2) TKL
  4. BMP Receptor STKR
  5. BMP Type II Receptor (BMPR2)
  6. BMX Protein, Human (sf9, His)

BMX proteins are nonreceptor tyrosine kinases that centrally regulate various signaling pathways that control actin dynamics, migration, proliferation, and survival. BMX participates in signal transduction of multiple receptors such as integrins, growth factor receptors, and cytokine receptors, induces BCAR1 tyrosine phosphorylation, and plays a key role in TNF-induced angiogenesis. BMX Protein, Human (sf9, His) is the recombinant human-derived BMX protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMX proteins are nonreceptor tyrosine kinases that centrally regulate various signaling pathways that control actin dynamics, migration, proliferation, and survival. BMX participates in signal transduction of multiple receptors such as integrins, growth factor receptors, and cytokine receptors, induces BCAR1 tyrosine phosphorylation, and plays a key role in TNF-induced angiogenesis. BMX Protein, Human (sf9, His) is the recombinant human-derived BMX protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

BMX Protein, a non-receptor tyrosine kinase, assumes central and diverse modulatory roles in various signaling pathways governing actin reorganization, cell migration, proliferation, survival, adhesion, and apoptosis. It actively participates in signal transduction initiated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors, and integrins. BMX induces tyrosine phosphorylation of BCAR1 in response to integrin regulation, facilitated by PTK2/FAK1, a pivotal mediator of integrin signaling events crucial for actin cytoskeleton regulation and cell motility. It plays a critical role in TNF-induced angiogenesis and is implicated in the signaling of TEK and FLT1 receptors, both essential for angiogenesis. BMX is indispensable for the phosphorylation and activation of STAT3, a transcription factor crucial in cell differentiation, and is involved in interleukin-6 (IL6) induced differentiation. Additionally, BMX plays a role in programming adaptive cytoprotection against extracellular stress in various cell systems, including salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. Its potential involvement in the regulation of endocytosis through interaction with the endosomal protein RUFY1 and its role in the growth and differentiation of hematopoietic cells further underscore its multifaceted functions. Additionally, BMX contributes to signal transduction in endocardial and arterial endothelial cells.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

P51813 (E411-H675)

Gene ID

660

Molecular Construction
N-term
8*His
BMX (E411-H675)
Accession # P51813
C-term
Protein Length

Partial

Synonyms
BMX; Cytoplasmic tyrosine-protein kinase BMX; Bone marrow tyrosine kinase gene in chromosome X protein; Epithelial and endothelial tyrosine kinase; ETK; NTK38
AA Sequence

ELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BMX Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMX Protein, Human (sf9, His)
Cat. No.:
HY-P701712
Quantity:
MCE Japan Authorized Agent: