BRD3 Protein, Human (BD2, His)

BRD3 Protein, Human (BD2, His) is the recombinant human-derived BRD3, expressed by E. coli, with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BRD3 Protein, Human (BD2, His) is the recombinant human-derived BRD3, expressed by E. coli, with N-6*His labeled tag.

Background

BRD3 is a chromatin reader that recognizes and binds acetylated histones, thereby controlling gene expression and remodeling chromatin structures. It recruits transcription factors and coactivators to target gene sites and activates RNA polymerase II machinery for transcriptional elongation. In vitro, BRD3 binds acetylated lysine residues on the N-terminus of histones H2A, H2B, H3, and H4. During endoderm differentiation, BRD3 associates with the long non-coding RNA (lncRNA) DIGIT, undergoing liquid-liquid phase separation to promote binding to histone H3 acetylated at Lys-18 (H3K18ac), thereby inducing endoderm gene expression. Additionally, BRD3 binds non-histone acetylated proteins such as GATA1 and GATA2 (by similar): it regulates transcription by promoting the binding of transcription factor GATA1 to its targets.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • BRD3 (G306-D417)
      Accession # Q15059-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BRD3; Bromodomain-Containing Protein 3; Bromodomain Containing 3; RING3-Like Protein; RING3L; Bromodomain-Containing Protein 3 Short Isoform; KIAA0043; Bromodomain-Containing 3; FSHRG2; Alternative Protein BRD3; ORFX; RING3-Like; Female Sterile Homeotic R

  • AA Sequence

    GKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD

  • Predicted Molecular Mass

    14.1 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00