BTLA/CD272 Protein, Mouse (HEK293, hFc)
Based on 1 Customer Validation
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived BTLA/CD272 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived BTLA/CD272 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
BTLA/CD272, an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation.
Verified Bioactivity
Immobilized mouse BTLA-Fc at 10 μg/ml (100 μl/well) can bind biotinylated mouse HVEM-Fch, The EC50 of biotinylated mouse HVEM-Fch is 15.7-38.334 ng/ml.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q32MV9 (E30-G176,(K173E))
-
Molecular Construction
-
N-term
-
BTLA (E30-G176,K173E)
Accession # Q32MV9 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
BTLA; BTLA1; B And T Lymphocyte Associated; CD272; B- And T-Lymphocyte-Associated Protein; Alternative Protein BTLA; B- And T-Lymphocyte Attenuator; CD272 Antigen
-
AA Sequence
EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEERPG
-
Predicted Molecular Mass
43.8 kDa
-
Molecular Weight
Approximately 57-62 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
