BTLA/CD272 Protein, Mouse (HEK293, His)
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTLA/CD272 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTLA/CD272 protein, expressed by HEK293 , with C-His labeled tag.
Background
BTLA/CD272, an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q32MV9/AAI08964.1 (E30-G176)
-
Molecular Construction
-
N-term
-
BTLA (E30-G176)
Accession # Q32MV9/AAI08964.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
BTLA; BTLA1; B And T Lymphocyte Associated; CD272; B- And T-Lymphocyte-Associated Protein; Alternative Protein BTLA; B- And T-Lymphocyte Attenuator; CD272 Antigen
-
AA Sequence
EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
