C1D Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

Background

C1D, a multifaceted protein, orchestrates various cellular processes with distinct functional implications. It plays a pivotal role in recruiting the RNA exosome complex to pre-rRNA, facilitating the intricate 3'-5' end processing of the 5.8S rRNA, possibly in collaboration with MPHOSPH6. Additionally, C1D exhibits a unique capability to activate PRKDC, not only in the presence of linear DNA but also in the presence of supercoiled DNA. Notably, it can induce apoptosis through a p53/TP53 dependent pathway, showcasing its regulatory role in programmed cell death. Furthermore, C1D may modulate the formation of the TRAX/TSN complex and enhances transcriptional repression by NR1D1 and THRB. As a molecular entity, C1D exists in monomeric and homodimeric forms, interacting with a spectrum of proteins including NR1D1, THRA, THRB, NCOR1, NCOR2, EXOSC10, TSNAX, and RAC3. This intricate network of interactions underscores the diverse functions and regulatory potential of C1D in cellular biology.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • C1D (M1-S141)
      Accession # Q13901
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    C1D; Small Unique Nuclear Receptor Co-Repressor; C1D Nuclear Receptor Corepressor; C1D Nuclear Receptor Co-Repressor; Nuclear Nucleic Acid-Binding Protein C1D; HC1D; SUN-CoR; Small Unique Nuclear Receptor Corepressor; SUNCOR; Nuclear DNA-Binding Protein;

  • AA Sequence

    MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00