Copy Link Print Information

C1QTNF3/CTRP3 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-尾1/Smad, Sirtuin 1/NF-魏B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for C1QTNF3/CTRP3 Protein, Human (His)
  • Experimental Validation Results for C1QTNF3/CTRP3 Protein, Human (His)
  • C1QTNF3/CTRP3 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-尾1/Smad, Sirtuin 1/NF-魏B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

Background

C1q/ TNF-associated proteins (CTRPs) are a family of secreted proteins with a specific structure. CTRPs have a wide range of effects on survival signaling, inflammation, metabolism and insulin sensitization. Complement C1q tumor necrosis factor-related protein 3 inhibits proliferation, migration, and ECM accumulation in keloid fibroblasts by regulating TGF-β1/Smad signaling pathway. Play an anti-fibrotic role. C1QTNF3 is involved in the pathogenesis and insulin resistance of polycystic ovary syndrome (PCOS). C1qtnf3 reduces intestinal inflammation through the Sirtuin 1/NF-κB signaling pathway. C1QTNF3 affects lipid metabolism and necrotic inflammation of renal tubular cells through AMPK signaling pathway. C1QTNF3 alleviates myocardial ischemia/reperfusion injury in mice by activating the LAMP1/JIP2/JNK pathway[1][2][3][4][5].

Verified Bioactivity

Immobilized Human CTRP3 at 4 μg/mL (100 μL/well) can bind Human CD36 Protein. The ED50 for this effect is 4.475 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q9BXJ4-1 (Q23-K246)

  • Gene ID
    114899  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • C1QTNF3 (Q23-K246)
      Accession # Q9BXJ4-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    C1QTNF3; C1q And Tumor Necrosis Factor Related Protein 3; C1q And TNF Related 3; Secretory Protein CORS26; CTRP3; 2310005P21Rik; Cors-26; Cartonectin; Corcs; CORS26; Cors; Collagenous Repeat-Containing Sequence Of 26-KDa; Complement C1q Tumor Necrosis Fac

  • AA Sequence

    QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

  • Molecular Weight

    Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human CTRP3 at 4 μg/mL (100 μL/well) can bind Human CD36 Protein. The ED50 for this effect is 4.475 μg/mL.

  • C1QTNF3/CTRP3 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for C1QTNF3/CTRP3 Protein, Human (His)
  • Experimental Validation Results for C1QTNF3/CTRP3 Protein, Human (His)
  • C1QTNF3/CTRP3 Protein, Human (His) Product Image