Copy Link Print Information

CADM2/IGSF4D Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CADM2/IGSF4D Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

Background

CADM2, also known as IGSF4D, serves as an adhesion molecule facilitating both homo- and heterophilic interactions with other members of the nectin-like family, thereby promoting cell aggregation. This protein holds significance in synapse organization, playing a crucial role in regulated trans-synaptic adhesion. Notably, CADM2 exhibits a preference for binding to oligodendrocytes, emphasizing its involvement in cellular interactions within the nervous system.

Verified Bioactivity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.052 μg/mL, corresponding to a specific activity is 950.570 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8N3J6-2 (G30-D335)

  • Gene ID
    253559  [NCBI]
  • Molecular Construction
    • N-term
    • CADM2 (G30-D335)
      Accession # Q8N3J6
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CADM2; Synaptic Cell Adhesion Molecule 2; Prev. IGSF4D; Nectin-Like 3; NECL3; SynCAM 2; SynCAM-2; Immunoglobulin Superfamily, Member 4D; SynCAM2; Cell Adhesion Molecule 2 Isoform 4; Necl-3; NECL-3; Immunoglobulin Superfamily Member 4D; IgSF4D; Cell Adhesi

  • AA Sequence

    GSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD

  • Molecular Weight

    Approximately 40-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CADM2/IGSF4D Protein, Human (HEK293, His) Product Image
    1/16
  • CADM2/IGSF4D Protein, Human (HEK293, His) Product Image