CALML5 Protein, Human (His)
Based on 1 Customer Validation
The CALML5 protein is known for its calcium-binding ability and may be involved in terminal differentiation of keratinocytes, suggesting a role in skin cell maturation. Its association with transglutaminase 3 suggests cooperation in skin development function. CALML5 Protein, Human (His-GST) is the recombinant human-derived CALML5 protein, expressed by E. coli , with N-His, N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CALML5 protein is known for its calcium-binding ability and may be involved in terminal differentiation of keratinocytes, suggesting a role in skin cell maturation. Its association with transglutaminase 3 suggests cooperation in skin development function. CALML5 Protein, Human (His-GST) is the recombinant human-derived CALML5 protein, expressed by E. coli , with N-His, N-GST labeled tag.
Background
The CALML5 Protein is characterized by its calcium-binding capacity and may play a role in the terminal differentiation of keratinocytes. This suggests a potential involvement in key processes associated with the maturation and specialization of these skin cells. Notably, CALML5 associates with transglutaminase 3, indicating a possible collaborative role in cellular functions related to skin development and maintenance. The calcium-binding property of CALML5 likely contributes to its regulatory functions in these processes, underscoring its significance in the intricate molecular mechanisms governing keratinocyte differentiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9NZT1 (M1-E146)
-
Molecular Construction
-
N-term
-
His-GST
-
CALML5 (M1-E146)
Accession # Q9NZT1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CALML5; Calmodulin-Like Skin Protein; Calmodulin Like 5; Calmodulin-Like Protein 5; CLSP; Calmodulin-Like 5
-
AA Sequence
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
