1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CASP6 Protein, Human (Active)

CASP6 Protein, Human (Active) is the recombinant human-derived CASP6, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CASP6 Protein, Human (Active) is the recombinant human-derived CASP6, expressed by E. coli , with tag Free labeled tag.

Background

CASP6 is a cysteine protease that plays essential roles in programmed cell death, axonal degeneration, development, and innate immunity. It acts as a non-canonical executioner caspase during apoptosis by cleaving nuclear structural proteins NUMA1 and lamin A/LMNA, inducing nuclear shrinkage and fragmentation. CASP6 promotes hepatocyte apoptosis through BID cleavage, contributing to nonalcoholic steatohepatitis. It also cleaves transcription factors like NF-kappa-B and CREBBP, and serves as a central mediator of ZBP1-induced PANoptosis (a hybrid of pyroptosis, apoptosis, and necroptosis) in antiviral defense. Additionally, CASP6 is involved in axon pruning and B-cell program regulation. Similar functions (by similar) include cleaving PARK7/DJ-1 and phospholipid scramblase proteins XKR4/XKR9. During viral infection, CASP6 proteolytically cleaves coronavirus N proteins (e.g., MERS-CoV, SARS-CoV), modulating viral replication by inhibiting IRF3 nuclear translocation and interferon signaling.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P55212-1 (A24-N293)

Gene ID

839

Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
MCH2
AA Sequence

AFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN

Predicted Molecular Mass
31 kDa
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CASP6 Protein, Human (Active) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CASP6 Protein, Human (Active)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CASP6 Protein, Human (Active)
Cat. No.:
HY-P703550
Quantity:
MCE Japan Authorized Agent: