CASP6 Protein, Human (Active)
CASP6 Protein, Human (Active) is the recombinant human-derived CASP6, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CASP6 Protein, Human (Active) is the recombinant human-derived CASP6, expressed by E. coli , with tag Free labeled tag.
CASP6 is a cysteine protease that plays essential roles in programmed cell death, axonal degeneration, development, and innate immunity. It acts as a non-canonical executioner caspase during apoptosis by cleaving nuclear structural proteins NUMA1 and lamin A/LMNA, inducing nuclear shrinkage and fragmentation. CASP6 promotes hepatocyte apoptosis through BID cleavage, contributing to nonalcoholic steatohepatitis. It also cleaves transcription factors like NF-kappa-B and CREBBP, and serves as a central mediator of ZBP1-induced PANoptosis (a hybrid of pyroptosis, apoptosis, and necroptosis) in antiviral defense. Additionally, CASP6 is involved in axon pruning and B-cell program regulation. Similar functions (by similar) include cleaving PARK7/DJ-1 and phospholipid scramblase proteins XKR4/XKR9. During viral infection, CASP6 proteolytically cleaves coronavirus N proteins (e.g., MERS-CoV, SARS-CoV), modulating viral replication by inhibiting IRF3 nuclear translocation and interferon signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P55212-1 (A24-N293)
-
Gene ID839
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
CASP6; Caspase 6, Apoptosis-Related Cysteine Protease; Caspase 6; Mammalian Ced-3 Homologue 2; Caspase-6; Apoptotic Protease MCH-2; CSP-6; Apoptotic Protease Mch-2; MCH2; CASP-6; Caspase 6, Apoptosis-Related Cysteine Peptidase
-
AA Sequence
AFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
-
Predicted Molecular Mass
31 kDa
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
