Caspase-8/CASP8 subunit p18 Protein, Human (His)
Based on 1 Customer Validation
The Caspase-8/CASP8 subunit p18 protein is a key thiol protease that acts as a molecular switch in programmed cell death processes, including apoptosis, necroptosis, and pyroptosis. It is essential for preventing tissue damage by inducing exogenous apoptosis by cleaving and activating effector caspases. Caspase-8/CASP8 subunit p18 Protein, Human (His) is the recombinant human-derived Caspase-8/CASP8 subunit p18 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Caspase-8/CASP8 subunit p18 protein is a key thiol protease that acts as a molecular switch in programmed cell death processes, including apoptosis, necroptosis, and pyroptosis. It is essential for preventing tissue damage by inducing exogenous apoptosis by cleaving and activating effector caspases. Caspase-8/CASP8 subunit p18 Protein, Human (His) is the recombinant human-derived Caspase-8/CASP8 subunit p18 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Caspase-8/CASP8 subunit p18 Protein, a pivotal thiol protease, serves as a molecular switch orchestrating programmed cell death processes such as apoptosis, necroptosis, and pyroptosis. Essential for preventing tissue damage during embryonic development and adulthood, this initiator protease induces extrinsic apoptosis by cleaving and activating effector caspases, including CASP3, CASP4, CASP6, CASP7, CASP9, and CASP10. Acting as the initiator in death-inducing signaling complexes (DISC) formed in response to TNFRSF6/FAS or TNFRSF1A signals, it liberates the active dimeric enzyme, enabling downstream apoptotic protease activation. Additionally, Caspase-8 negatively regulates necroptosis by cleaving RIPK1 and functions as a regulator of pyroptosis, initiating the cleavage and activation of gasdermin-C and -D. This multifaceted protease plays a role in innate immunity by cleaving and inactivating N4BP1 downstream of TLR3 or TLR4, promoting cytokine production. While lacking a catalytic site, Caspase-8 may interfere with the pro-apoptotic activity of the complex.
Verified Bioactivity
Caspase-8/CASP8 subunit p18 Protein, Human (His) lacks of Caspase-8 enzyme activity because it contains only one subunit.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q14790 (S217-D374)
-
Molecular Construction
-
N-term
-
6*His
-
CASP8 (S217-D374)
Accession # Q14790 -
C-term
-
-
Protein Length
Full Length of CASP8 subunit p18 Chain
-
Synonyms
CASP8; Apoptotic Cysteine Protease; Caspase 8; Apoptotic Protease Mch-5; FLICE; FADD-Like ICE; MCH5; CAP4; MACH; FADD-Homologous ICE/CED-3-Like Protease; Caspase-8; FADD-Homologous ICE/Ced-3-Like Protease; Casp-8; MACH-Beta-1/2/3/4 Protein; Caspase 8, Apo
-
AA Sequence
SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
-
Predicted Molecular Mass
21.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
