CCR1 Protein, Mouse (Cell-Free, His)
CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.
CCR1, a receptor belonging to the C-C type chemokine family, serves as a binding site for chemokines such as MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1. Upon ligand binding, CCR1 initiates signal transduction processes that lead to an elevation in intracellular calcium ion levels. This receptor plays a pivotal role in modulating stem cell proliferation, contributing to the regulation of cellular processes critical for tissue homeostasis and immune responses. Additionally, CCR1 interacts with CREB3, potentially participating in the intricate network of signaling pathways that govern cellular functions.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P51675 (M1-F355)
-
Gene ID12768
-
Molecular Construction
-
N-term
-
10*His
-
CCR1 (M1-F355)
Accession # P51675 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CCR1; MIP-1alpha-R; Prev. CMKBR1; CC-CKR-1; Prev. SCYAR1; RANTES-R; Chemokine (C-C Motif) Receptor 1; HM145; MIP1aR; CCR-1; CKR-1; RANTES Receptor; CD191; CD191 Antigen; Macrophage Inflammatory Protein 1-Alpha Receptor; CMKR1; C-C Chemokine Receptor Type
-
AA Sequence
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
-
Predicted Molecular Mass
43.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
