CD105/Endoglin Protein, Human (Trx-His)
Based on 1 Customer Validation
CD105/Endoglin Protein, Human (Trx-His) is an accessory receptor for transforming growth factor beta (TGF-β), and is expressed on endothelial cells.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD105/Endoglin Protein, Human (Trx-His) is an accessory receptor for transforming growth factor beta (TGF-β), and is expressed on endothelial cells.
Background
Endoglin (CD105) is an accessory receptor for transforming growth factor beta (TGF-β) and its expression is up-regulated in actively proliferating endothelial cells. Endoglin is co-expressed with β-glycan, another component of the TGF-βR complex, in the microvascular endothelium of normal tissue. Endoglin is an appropriate marker for tumor-related angiogenesis and neovascularization. The endothelial cells of neoplasms are more prolific than endothelial cells of normal tissue and thus they express elevated endoglin levels[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Trx;N-6*His
-
Accession
AAH14271.1 (E26-Q176)
-
Molecular Construction
-
N-term
-
Trx-6*His
-
ENG (E26-Q176)
Accession # AAH14271.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ENG; CD105 Antigen; Prev. ORW1; Endoglin (Osler-Rendu-Weber Syndrome 1); Prev. ORW; Osler-Rendu-Weber Syndrome 1; END; Soluble Endoglin; HHT1; ENG Protein; Endoglin; CD105
-
AA Sequence
ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)