CD105/Endoglin Protein, Mouse (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

Background

CD105/Endoglin, a vascular endothelium glycoprotein, plays a crucial role in angiogenesis regulation, contributing to the normal structure and integrity of adult vasculature. Essential for maintaining the structural integrity of the vasculature, CD105/Endoglin also influences the migration of vascular endothelial cells. Its significance extends to extraembryonic angiogenesis and embryonic heart development, underscoring its essential role in vascular development. CD105/Endoglin may modulate endothelial cell responses to blood flow, impacting vascular remodeling and the establishment of normal vascular morphology during angiogenesis. Functioning as a TGF-beta coreceptor, it is involved in the TGF-beta/BMP signaling cascade, leading to the activation of SMAD transcription factors. Furthermore, CD105/Endoglin interacts with various molecules, including TGFB1, GDF2, ACVRL1, BMP10, DYNLT4, and ARRB2, highlighting its multifaceted involvement in cellular processes. The protein forms homodimers through disulfide linkages and engages in heteromeric complexes with TGF-beta signaling receptors. Additionally, CD105/Endoglin binds TGFB1 and TGFB2 with high affinity, further emphasizing its intricate role in molecular interactions.

Verified Bioactivity

Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 25-100 ng/mL in the presence of 2 ng/mL of recombinant human BMP9.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD105 (R28-G581)
      Accession # Q63961
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ENG; CD105 Antigen; Prev. ORW1; Endoglin (Osler-Rendu-Weber Syndrome 1); Prev. ORW; Osler-Rendu-Weber Syndrome 1; END; Soluble Endoglin; HHT1; ENG Protein; Endoglin; CD105

  • AA Sequence

    RVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

  • Predicted Molecular Mass

    61.2 kDa

  • Molecular Weight

    Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00