Copy Link Print Information

CD105/Endoglin Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD105/Endoglin Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD105/Endoglin, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD105/Endoglin Protein, Mouse (HEK293, His)
  • Experimental Validation Results for CD105/Endoglin Protein, Mouse (HEK293, His)
  • CD105/Endoglin Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD105/Endoglin Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD105/Endoglin, expressed by HEK293 , with C-10*His labeled tag.

Background

CD105/Endoglin Protein is a vascular endothelium glycoprotein that plays a crucial role in angiogenesis regulation, maintaining the structure and integrity of adult vasculature. It also controls the migration of vascular endothelial cells and contributes to extraembryonic angiogenesis and embryonic heart development. CD105/Endoglin Protein is involved in endothelial cell shape changes in response to blood flow, facilitating vascular remodeling during angiogenesis. Additionally, it acts as a coreceptor for TGF-beta, participating in the TGF-beta/BMP signaling cascade and activating SMAD transcription factors. CD105/Endoglin Protein forms dimers and interacts with various receptors, including TGFBR1, TGFBR2, GDF2, ACVRL1, BMP10, DYNLT4, and ARRB2.

Verified Bioactivity

Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    NP_031958.2 (E27-K580)

  • Gene ID
    13805
  • Protein Length

    Extracellular Domain

  • Synonyms

    ENG; CD105 Antigen; Prev. ORW1; Endoglin (Osler-Rendu-Weber Syndrome 1); Prev. ORW; Osler-Rendu-Weber Syndrome 1; END; Soluble Endoglin; HHT1; ENG Protein; Endoglin; CD105

  • AA Sequence

    ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGK

  • Predicted Molecular Mass

    59.8 kDa

  • Molecular Weight

    Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED50 for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

  • CD105/Endoglin Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD105/Endoglin Protein, Mouse (HEK293, His)
  • Experimental Validation Results for CD105/Endoglin Protein, Mouse (HEK293, His)
  • CD105/Endoglin Protein, Mouse (HEK293, His) Product Image