CD105/Endoglin Protein, Mouse (HEK293, His)

CD105/Endoglin Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD105/Endoglin, expressed by HEK293 , with C-10*His labeled tag.

CD105/Endoglin Protein is a vascular endothelium glycoprotein that plays a crucial role in angiogenesis regulation, maintaining the structure and integrity of adult vasculature. It also controls the migration of vascular endothelial cells and contributes to extraembryonic angiogenesis and embryonic heart development. CD105/Endoglin Protein is involved in endothelial cell shape changes in response to blood flow, facilitating vascular remodeling during angiogenesis. Additionally, it acts as a coreceptor for TGF-beta, participating in the TGF-beta/BMP signaling cascade and activating SMAD transcription factors. CD105/Endoglin Protein forms dimers and interacts with various receptors, including TGFBR1, TGFBR2, GDF2, ACVRL1, BMP10, DYNLT4, and ARRB2.

Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED₅₀ for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

• 
  Measured by its ability to inhibit BMP9-induced alkaline phosphatase production by MC3T3E1 mouse chondrogenic cells. The ED₅₀ for this effect is typically 121.6 ng/mL in the presence of 2 ng/mL of recombinant human BMP9, corresponding to a specific activity is 8223.6842 units/mg.

Mouse

HEK293

C-10*His

NP_031958.2 (E27-K580)

13805

Partial

ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGK

Approximately 75-85 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.