Copy Link Print Information

GM-CSF R alpha Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity. GM-CSF R alpha binds to GM-CSF and induces cell differentiation. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA). GM-CSF R alpha Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 298 amino acids (E23-G320) and is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • GM-CSF R alpha Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity[1]. GM-CSF R alpha binds to GM-CSF and induces cell differentiation[2]. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA)[3]. GM-CSF R alpha Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 298 amino acids (E23-G320) and is produced in HEK293 cells.

Background

GM-CSF R alpha is expressed on myeloid cells and on some non-hemopoietic cells, such as endothelial cells, not on T cells[2].
The amino acid sequence of human GM-CSF R alpha protein has low homology for mouse GM-CSF R alpha protein.
GM-CSF receptor (GM-CSFR) consists of two subunits, an α-subunit, which binds the cytokine with low affinity, and a larger β-subunit (beta common; βc), responsible for signaling, forming a ternary receptor complex. Signal transduction in response to the cytokines interleukin (IL)-3 and IL-5 is also mediated by βc; therefore, receptor specificity is due to GM-CSFRα[1]. After binding GM-CSF to its receptor, Janus-kinase-2 (JAK-2) is recruited to the cytoplasmic domain of the β chain, and activation of JAK-2 occurs, which subsequently induces STAT-5 phosphorylation. This signaling pathway induces migration of STAT-5 dimers to the nucleus and promotes the transcription of various genes such as pim-1 and CIS to induce cell differentiation[2].
GM-CSFR α-subunit significantly increases positive synovial macrophages in the RA synovium. GM-CSFR α monoclonal antibody suppresses disease activity in the murine collagen-induced arthritis model[3].

Verified Bioactivity

1. Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells.The ED50 for this effect is 0.5-2.509 μg/mL.
2. Loaded Mavrilimumab (HY-P99031) on AHC2 biosensor, can bind GM-CSF R alpha Protein, Human (HEK293, His) with an affinity constant of 7.867E-10 M as determined in BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 2.509 μg/mL in the presence of 40 pg/mL of rhGM-CSF. corresponding to a specific activity is 398.5652 units/mg.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Mavrilimumab (HY-P99031) on AHC2 biosensor, can bind GM-CSF R alpha Protein, Human (HEK293, His) with an affinity constant of 7.867E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P15509 (E23-G320)

  • Gene ID
    1438  [NCBI]
  • Molecular Construction
    • N-term
    • GM-CSF R alpha (E23-G320)
      Accession # P15509
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CSF2RA; GMCSFR-Alpha; Prev. CSF2R; CDw116; AlphaGMR; CSF2RY; CD116; Granulocyte-Macrophage Colony-Stimulating Factor Receptor Alpha Chain; Colony Stimulating Factor 2 Receptor, Alpha, Low-Affinity (Granulocyte-Macrophage); CSF2RAX; Granulocyte-Macrophage

  • AA Sequence

    EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

  • Molecular Weight

    Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Hansen G, et al. The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation. Cell. 2008 Aug 8;134(3):496-507. [Content Brief]

[2]. Martinez-Moczygemba M, et, al. Biology of common beta receptor-signaling cytokines: IL-3, IL-5, and GM-CSF. J Allergy Clin Immunol. 2003 Oct;112(4):653-65; quiz 666. [Content Brief]

[3]. Lotfi N, et al. Roles of GM-CSF in the Pathogenesis of Autoimmune Diseases: An Update. Front Immunol. 2019 Jun 4;10:1265. [Content Brief]

[4]. Goldstein JI, et, al. Defective leukocyte GM-CSF receptor (CD116) expression and function in inflammatory bowel disease. Gastroenterology. 2011 Jul;141(1):208-16. [Content Brief]

[5]. Cook AD, et al. Granulocyte macrophage colony-stimulating factor receptor α expression and its targeting in antigen-induced arthritis and inflammation. Arthritis Res Ther. 2016 Dec 1;18(1):287. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 2.509 μg/mL in the presence of 40 pg/mL of rhGM-CSF. corresponding to a specific activity is 398.5652 units/mg.

  • 1/16

    MedChemExpress Validation
     Loaded Mavrilimumab (HY-P99031) on AHC2 biosensor, can bind GM-CSF R alpha Protein, Human (HEK293, His) with an affinity constant of 7.867E-10 M as determined in BLI assay.

  • GM-CSF R alpha Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • Experimental Validation Results for GM-CSF R alpha Protein, Human (HEK293, His)
  • GM-CSF R alpha Protein, Human (HEK293, His) Product Image