CD14 Protein, Human (Biotinylated, HEK293, His-Avi)
The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD14 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is 325 a.a., with molecular weight of 45-55 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD14 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is 325 a.a., with molecular weight of 45-55 kDa.
Background
CD14 serves as a crucial coreceptor for bacterial lipopolysaccharide (LPS), playing a pivotal role in the innate immune response to microbial pathogens. In collaboration with LBP, CD14 binds monomeric LPS and facilitates its delivery to the LY96/TLR4 complex, initiating downstream signaling events. This process involves the activation of MyD88, TIRAP, and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response. Additionally, CD14 acts as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively, with these clusters triggering signaling and subsequently translocating to the Golgi in a lipid-raft dependent pathway. CD14's interaction with electronegative LDL (LDL(-)) contributes to the cytokine release induced by LDL(-). CD14 is an integral component of the lipopolysaccharide (LPS) receptor complex, collaborating with LY96 and TLR4. Furthermore, it interacts with various partners, such as LPS-bound LBP, LPAR1, MYO18A, and FSTL1, underscoring its multifaceted role in immune responses and lipid metabolism.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P08571 (T20-M344)
-
Protein Length
Full Length of CD14, membrane-bound form
-
Conjugation
Biotin
-
Synonyms
CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen
-
AA Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM
-
Predicted Molecular Mass
38.6 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)