1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD14
  5. CD14 Protein, Human (Biotinylated, HEK293, His-Avi)

CD14 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78918
Handling Instructions Technical Support

The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD14 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is 325 a.a., with molecular weight of 45-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD14 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD14 Protein, Human (Biotinylated, HEK293, His-Avi) is 325 a.a., with molecular weight of 45-55 kDa.

Background

CD14 serves as a crucial coreceptor for bacterial lipopolysaccharide (LPS), playing a pivotal role in the innate immune response to microbial pathogens. In collaboration with LBP, CD14 binds monomeric LPS and facilitates its delivery to the LY96/TLR4 complex, initiating downstream signaling events. This process involves the activation of MyD88, TIRAP, and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response. Additionally, CD14 acts as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively, with these clusters triggering signaling and subsequently translocating to the Golgi in a lipid-raft dependent pathway. CD14's interaction with electronegative LDL (LDL(-)) contributes to the cytokine release induced by LDL(-). CD14 is an integral component of the lipopolysaccharide (LPS) receptor complex, collaborating with LY96 and TLR4. Furthermore, it interacts with various partners, such as LPS-bound LBP, LPAR1, MYO18A, and FSTL1, underscoring its multifaceted role in immune responses and lipid metabolism.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P08571 (T20-M344)

Gene ID

929  [NCBI]

Protein Length

Full Length of Monocyte differentiation antigen CD14, membrane-bound form

Conjugation

Biotin

Synonyms
Monocyte Differentiation Antigen CD14; CD14
AA Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM

Molecular Weight

45-55 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD14 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78918
Quantity:
MCE Japan Authorized Agent: