CD160 Protein, Rhesus macaque (HEK293, His)

CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation^[1][2].

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR⁺ T cells, and memory-phenotype, activated and effector CD8⁺ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8⁺ T cells^[1][2].

Rhesus Macaque

HEK293

C-6*His

G7MG20 (G25-L158)

696832  [NCBI]

Partial

MLMETGRGCCALAILLAIVDIQSGGCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTLHHHHHH

Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Cai G, et, al. The CD160, BTLA, LIGHT/HVEM pathway: a bidirectional switch regulating T-cell activation. Immunol Rev. 2009 May;229(1):244-58.  [Content Brief]

  [2]. Kaye J. CD160 and BTLA: LIGHTs out for CD4+ T cells. Nat Immunol. 2008 Feb;9(2):122-4.  [Content Brief]