CD160 Protein, Rhesus macaque (HEK293, His)

CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1][2].

Background

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR+ T cells, and memory-phenotype, activated and effector CD8+ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8+ T cells[1][2].

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD160 (G25-L158)
      Accession # G7MG20
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55

  • AA Sequence

    MLMETGRGCCALAILLAIVDIQSGGCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTLHHHHHH

  • Predicted Molecular Mass

    15.9 kDa

  • Molecular Weight

    Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00