1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Endothelial cell CD Proteins
  4. CD160
  5. CD160 Protein, Rhesus macaque (HEK293, His)

CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

CD160 Protein, Rhesus macaque (HEK293, His) is a recombinant rhesus macaque CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1][2].

Background

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR+ T cells, and memory-phenotype, activated and effector CD8+ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8+ T cells[1][2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

G7MG20 (G25-L158)

Gene ID
Molecular Construction
N-term
CD160 (G25-L158)
Accession # G7MG20
6*His
C-term
Protein Length

Partial

Synonyms
rHuCD160, His; CD160 antigen; CD160
AA Sequence

MLMETGRGCCALAILLAIVDIQSGGCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTLHHHHHH

Predicted Molecular Mass
15.9 kDa
Peso molecular

Approximately 16-30 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Referencias
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CD160 Protein, Rhesus macaque (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CD160 Protein, Rhesus macaque (HEK293, His)
Cat. No.:
HY-P7795
Cantidad:
MCE Japan Authorized Agent: