1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Endothelial cell CD Proteins
  4. CD160
  5. CD160 Protein, Rhesus Macaque (HEK293)

CD160 Protein, a member of the immunoglobulin 'superfamily' of proteins that binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived CD160 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD160 Protein, a member of the immunoglobulin 'superfamily' of proteins that binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1]. CD160 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived CD160 protein, expressed by HEK293 , with tag free.

Background

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR+ T cells, and memory-phenotype, activated and effector CD8+ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8+ T cells. Such effects have been attributed to the ability of CD160 to bind classical and nonclassical MHC class I molecules, although with apparent low affinity, requiring clustering of MHC class I molecules or overexpression of CD160 or MHC class I for detection of the interaction[1].

Species

Rhesus Macaque

Source

HEK293

Tag

Tag Free

Accession

G7MG20 (G25-L158)

Gene ID
Molecular Construction
N-term
CD160 (G25-L158)
Accession # G7MG20
C-term
Protein Length

Partial

Synonyms
CD160 antigen; CD160
AA Sequence

GCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTL

Predicted Molecular Mass
15.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD160 Protein, Rhesus Macaque (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD160 Protein, Rhesus Macaque (HEK293)
Cat. No.:
HY-P76775
Quantity:
MCE Japan Authorized Agent: