CD160 Protein, Rhesus Macaque (HEK293)
CD160 Protein, a member of the immunoglobulin 'superfamily' of proteins that binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived CD160 protein, expressed by HEK293 , with tag free.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD160 Protein, a member of the immunoglobulin 'superfamily' of proteins that binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1]. CD160 Protein, Rhesus Macaque (HEK293) is the recombinant Rhesus Macaque-derived CD160 protein, expressed by HEK293 , with tag free.
Background
CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR+ T cells, and memory-phenotype, activated and effector CD8+ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8+ T cells. Such effects have been attributed to the ability of CD160 to bind classical and nonclassical MHC class I molecules, although with apparent low affinity, requiring clustering of MHC class I molecules or overexpression of CD160 or MHC class I for detection of the interaction[1].
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag Tag Free
-
Accession
G7MG20 (G25-L158)
-
Molecular Construction
-
N-term
-
CD160 (G25-L158)
Accession # G7MG20 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55
-
AA Sequence
GCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTL
-
Predicted Molecular Mass
15.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
