CD177 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD177 Protein, Human (HEK293, His) is a recombinant human CD177 expressed in HEK 293 cells with a His tag at the N-terminus. CD177 Protein is an important biomarker of myeloproliferative diseases.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD177 Protein, Human (HEK293, His) is a recombinant human CD177 expressed in HEK 293 cells with a His tag at the N-terminus. CD177 Protein is an important biomarker of myeloproliferative diseases[1][2].
Background
The gene encoding NB1 glycoprotein, the molecule that carries HNA-2a, has been identified and is known as CD177. The gene encoding NB1 glycoprotein, the molecule that carries HNA-2a, has been identified and is known as CD177. CD177 has an important role in immunogenetics[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH29167.1 (L22-G407)
-
Molecular Construction
-
N-term
-
CD177 (L22-G407)
Accession # AAH29167.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of CD177 antigen Chain
-
Synonyms
CD177; NB1 Glycoprotein; CD177 Molecule; HNA-2a; PRV1; NB1 GP; NB1; HNA-2; CD177 Antigen; PRV-1; HNA2A; Polycythemia Rubra Vera 1; Polycythemia Rubra Vera Protein 1; Putative CD177 Protein; Human Neutrophil Alloantigen 2a; Cell Surface Receptor; Human Neu
-
AA Sequence
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEG
-
Predicted Molecular Mass
42.3 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Stroncek DF. Neutrophil-specific antigen HNA-2a, NB1 glycoprotein, and CD177. Curr Opin Hematol. 2007 Nov;14(6):688-93. [Content Brief]
[2]. Kissel K, et, al. Molecular basis of the neutrophil glycoprotein NB1 (CD177) involved in the pathogenesis of immune neutropenias and transfusion reactions. Eur J Immunol. 2001 May;31(5):1301-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
