1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD20
  5. CD20/MS4A1 Protein, Human (His-Avi)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (His-Avi) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (His-Avi) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with C-Avi, C-His labeled tag.

Background

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Species

Human

Source

E. coli

Tag

C-Avi;C-6*His

Accession

P11836-1 (I141-S188)

Gene ID

931  [NCBI]

Molecular Construction
N-term
CD20 (I141-S188)
Accession # P11836-1
6*His-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
MS4A1; CD20; MS4A-1; B-lymphocyte surface antigen B1; Bp35; Leukocyte surface antigen Leu-16; Membrane-spanning 4-domains subfamily A member 11
AA Sequence

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Predicted Molecular Mass
16.8 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD20/MS4A1 Protein, Human (His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD20/MS4A1 Protein, Human (His-Avi)
Cat. No.:
HY-P78086
Quantity:
MCE Japan Authorized Agent: