CD20/MS4A1 Protein, Human (His-Avi)
CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (His-Avi) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with C-Avi, C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (His-Avi) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with C-Avi, C-His labeled tag.
Background
The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Avi;C-6*His
-
Accession
P11836-1 (I141-S188)
-
Molecular Construction
-
N-term
-
CD20 (I141-S188)
Accession # P11836-1 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MS4A1; CD20 Antigen; Prev. CD20; B-Lymphocyte Cell-Surface Antigen B1; Bp35; B-Lymphocyte Surface Antigen B1; FMC7; CD20 Receptor; B1; LEU-16; Membrane-Spanning 4-Domains, Subfamily A, Member 1; CVID5; Leukocyte Surface Antigen Leu-16; S7; B-Lymphocyte An
-
AA Sequence
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
