1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD20
  5. CD20/MS4A1 Protein, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
500 μg Auf Lager
> 500 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Background

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Biologische Aktivität

1. Measured by its binding ability in a functional ELISA. Immobilized Human CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED50 for this effect is 0.3077-0.5525 μg/mL.
2. Loaded Tositumomab (HY-P99326) on AHC2 biosensor, can bind CD20/MS4A1 Protein, Human (Trx-His) with an affinity constant of <1.000E-11 M as determined in BLI assay.

  • Loaded Tositumomab (HY-P99326) on AHC2 biosensor, can bind CD20/MS4A1 Protein, Human (Trx-His) with an affinity constant of <1.000E-11 M as determined in BLI assay.
Species

Human

Source

E. coli

Tag

N-Trx;N-6*His

Accession

P11836-1 (I141-S188)

Gene ID

931  [NCBI]

Protein Length

Extracellular Domain

Synonyms
rHuB-lymphocyte antigen CD20/CD20, Trx-His; MS4A1; CD20; MS4A-1; B1; Bp35; CVID5; LEU-16; MS4A2; S7
AA Sequence

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molekulargewicht

approximately 20.91 kDa

Reinheit
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

CD20/MS4A1 Protein, Human (Trx-His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
CD20/MS4A1 Protein, Human (Trx-His)
Art. -Nr.:
HY-P7896A
Menge:
MCE Japan Authorized Agent: