CD20/MS4A1 Protein, Human (Trx-His)

CD20/MS4A1 Protein, a B-lymphocyte membrane protein, crucially regulates cellular calcium influx, essential for B-lymphocyte development, differentiation, and activation. As part of the store-operated calcium (SOC) channel, it promotes calcium influx upon B-cell receptor/BCR activation. CD20/MS4A1 forms homotetramers, contributing to its structural organization in calcium signaling. Interacting with both heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, emphasizes its involvement in the B-cell receptor complex, underscoring significance in B-cell activation and immune responses. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli, with N-Trx, N-6*His labeled tag. The total length of CD20/MS4A1 Protein, Human (Trx-His) is 48 a.a., with molecular weight of approximately 20.91 kDa.

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Data is not available.

Human

E. coli

N-Trx;N-6*His

P11836 (I141-S188)

931  [NCBI]

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

approximately 20.91 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.