CD20/MS4A1 Protein, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

1. Measured by its binding ability in a functional ELISA. Immobilized Human CD20, at 2 μg/mL (100 μL/well) can bind Anti-CD20 antibody. The ED₅₀ for this effect is 0.3077-0.5525 μg/mL.
2. Loaded Tositumomab (HY-P99326) on AHC2 biosensor, can bind CD20/MS4A1 Protein, Human (Trx-His) with an affinity constant of <1.000E-11 M as determined in BLI assay.

• 
  Loaded Tositumomab (HY-P99326) on AHC2 biosensor, can bind CD20/MS4A1 Protein, Human (Trx-His) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Human

E. coli

N-Trx;N-6*His

P11836-1 (I141-S188)

931  [NCBI]

Extracellular Domain

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

approximately 20.91 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.