Copy Link Print Information

CD28 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD28 Protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules. CD28 Protein, Canine (HEK293, His) is the recombinant canine-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD28 Protein, Canine (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD28 Protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules. CD28 Protein, Canine (HEK293, His) is the recombinant canine-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD28 plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules, including DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2. Isoform 3 specifically interacts with CD40LG, highlighting its multifaceted role in mediating immune responses and cellular signaling pathways[1][2].

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9GKP3 (T18-P153)

  • Gene ID
    403646  [NCBI]
  • Molecular Construction
    • N-term
    • CD28 (T18-P153)
      Accession # Q9GKP3
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)

  • AA Sequence

    TENKILVKQLPRLVVYNNEVNLSCKYTYNLFSKEFRASLYKGVDSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYPPPYIGNEKSNGTIIHVKEKHLCPDELFPDSSKP

  • Predicted Molecular Mass

    16.7 kDa

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD28 Protein, Canine (HEK293, His) Product Image
    1/16
  • CD28 Protein, Canine (HEK293, His) Product Image