CD300e Protein, Mouse (HEK293, hFc)

CD300e Protein is an immune activating receptor expressed by myeloid cells, suggesting its involvement in cellular signaling and immune responses. Engagement of CD300e provides survival signals to cells, triggering the expression of activation markers and the release of pro-inflammatory cytokines. The ligation of CD300e in monocytes blocks the expression of the human leukocyte antigen (HLA) class II, affecting its synthesis. In addition, CD300e recognizes sphingomyelin and thereby regulates nonclassical and intermediate monocyte functions through FcRγ and DAP12. CD300e Protein, Mouse (CHO, mFc) is the recombinant mouse-derived CD300e/LMIR6 protein, expressed by CHO , with C-mFc labeled tag.

CD300e is an immune activating receptor expressed by myeloid cells, suggesting its involvement in cellular signaling and immune responses. Engagement of CD300e provides survival signals to cells, triggering the expression of activation markers and the release of pro-inflammatory cytokines. The ligation of CD300e in monocytes blocks the expression of the human leukocyte antigen (HLA) class II, affecting its synthesis. This effect is associated with the transcription impairment of the signal transducer and activator of transcription 1 (STAT1), overcoming the capacity of interferon gamma (IFN-γ) to promote the expression of the antigen-presenting molecules. CD300e recognizes sphingomyelin and thereby regulates nonclassical and intermediate monocyte functions through FcRγ and DAP12. In addition, through interactions with TYROBP, CD300e may play a role in modulating cellular activities and coordinating immune responses^[1][2].

Mouse

HEK293

N-hFc

Q8K249/NP_742047.1 (L18-S154)

217306  [NCBI]

Partial

LTGPGSVSGYVGGSLRVQCQYSPSYKGYMKYWCRGPHDTTCKTIVETDGSEKEKRSGPVSIRDHASNSTITVIMEDLSEDNAGSYWCKIQTSFIWDSWSRDPSVSVRVNVFPATTPTLPATTAILPLVNSGQNLRIS

Approximately 49.8 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.