CD300e Protein, Mouse (HEK293, hFc)
CD300e Protein is an immune activating receptor expressed by myeloid cells, suggesting its involvement in cellular signaling and immune responses. Engagement of CD300e provides survival signals to cells, triggering the expression of activation markers and the release of pro-inflammatory cytokines. The ligation of CD300e in monocytes blocks the expression of the human leukocyte antigen (HLA) class II, affecting its synthesis. In addition, CD300e recognizes sphingomyelin and thereby regulates nonclassical and intermediate monocyte functions through FcRγ and DAP12. CD300e Protein, Mouse (CHO, mFc) is the recombinant mouse-derived CD300e/LMIR6 protein, expressed by CHO , with C-mFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD300e Protein is an immune activating receptor expressed by myeloid cells, suggesting its involvement in cellular signaling and immune responses. Engagement of CD300e provides survival signals to cells, triggering the expression of activation markers and the release of pro-inflammatory cytokines. The ligation of CD300e in monocytes blocks the expression of the human leukocyte antigen (HLA) class II, affecting its synthesis. In addition, CD300e recognizes sphingomyelin and thereby regulates nonclassical and intermediate monocyte functions through FcRγ and DAP12. CD300e Protein, Mouse (CHO, mFc) is the recombinant mouse-derived CD300e/LMIR6 protein, expressed by CHO , with C-mFc labeled tag.
Background
CD300e is an immune activating receptor expressed by myeloid cells, suggesting its involvement in cellular signaling and immune responses. Engagement of CD300e provides survival signals to cells, triggering the expression of activation markers and the release of pro-inflammatory cytokines. The ligation of CD300e in monocytes blocks the expression of the human leukocyte antigen (HLA) class II, affecting its synthesis. This effect is associated with the transcription impairment of the signal transducer and activator of transcription 1 (STAT1), overcoming the capacity of interferon gamma (IFN-γ) to promote the expression of the antigen-presenting molecules. CD300e recognizes sphingomyelin and thereby regulates nonclassical and intermediate monocyte functions through FcRγ and DAP12. In addition, through interactions with TYROBP, CD300e may play a role in modulating cellular activities and coordinating immune responses[1][2].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q8K249/NP_742047.1 (L18-S154)
-
Molecular Construction
-
N-term
-
hFc
-
CD302 (L18-S154)
Accession # Q8K249/NP_742047.1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD300E; CMRF35-Like Molecule 2; Prev. CD300LE; CMRF35-A5; IREM2; IREM-2; CLM2; PIgR-2; CD300e Antigen; CLM-2; Immune Receptor Expressed On Myeloid Cells 2; PIgR2; Polymeric Immunoglobulin Receptor 2; CD300 Antigen Like Family Member E; CD300 Antigen-Like
-
AA Sequence
LTGPGSVSGYVGGSLRVQCQYSPSYKGYMKYWCRGPHDTTCKTIVETDGSEKEKRSGPVSIRDHASNSTITVIMEDLSEDNAGSYWCKIQTSFIWDSWSRDPSVSVRVNVFPATTPTLPATTAILPLVNSGQNLRIS
-
Predicted Molecular Mass
41.1 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
