Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Fc gamma RIIB/CD32b Protein functions as a receptor for the Fc region of complexed immunoglobulins gamma, exhibiting low affinity. It plays a role in various effector and regulatory functions, including the phagocytosis of antigen-antibody complexes from the circulation and the modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but do not mediate endocytosis or phagocytosis, while isoform IIB2 can facilitate the endocytosis of soluble immune complexes via clathrin-coated pits. Both isoform IIB1 and isoform IIB2 can down-regulate the activation of B-cells, T-cells, and mast cells when coaggregated with B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively. Fc gamma RIIB/CD32b interacts with FGR and LYN (By similarity).
Verified Bioactivity
Loaded Recombinant Mouse CD32b on HIS1K Biosensor, can bind Recombinant Mouse IgG1 Fc with an affinity constant of 64.9 nM as determined in BLI assay.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P08101-1 (T30-P210)
-
Molecular Construction
-
N-term
-
Fc gamma RIIB/CD32b (T30-P210)
Accession # P08101-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R
-
AA Sequence
THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP
-
Predicted Molecular Mass
21.6 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
