CD34 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (HEK293, His) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (HEK293, His) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD34 protein is a potential adhesion molecule that is thought to play a crucial role in early hematopoiesis by facilitating the attachment of stem cells to the extracellular matrix of the bone marrow or directly to stromal cells. It is speculated that CD34 may also act as a scaffold for the binding of lineage-specific glycans, enabling stem cells to interact with lectins expressed by stromal cells or other components of the marrow. Additionally, CD34 is known to present carbohydrate ligands to selectins, further contributing to its involvement in cell adhesion processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P28906 (S32-T290)
-
Molecular Construction
-
N-term
-
CD34 (S32-T290)
Accession # P28906 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD34; CD34 Antigen; CD34 Molecule; CD34 Sialomucin; Hematopoietic Progenitor Cell Antigen CD34; Hematopoietic Progenital Cell Antigen CD34
-
AA Sequence
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
-
Predicted Molecular Mass
28.3 kDa
-
Molecular Weight
Approximately 60-96 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)