Copy Link Print Information

CD34 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (HEK293, His) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD34 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (HEK293, His) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD34 protein is a potential adhesion molecule that is thought to play a crucial role in early hematopoiesis by facilitating the attachment of stem cells to the extracellular matrix of the bone marrow or directly to stromal cells. It is speculated that CD34 may also act as a scaffold for the binding of lineage-specific glycans, enabling stem cells to interact with lectins expressed by stromal cells or other components of the marrow. Additionally, CD34 is known to present carbohydrate ligands to selectins, further contributing to its involvement in cell adhesion processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P28906 (S32-T290)

  • Gene ID
    947  [NCBI]
  • Molecular Construction
    • N-term
    • CD34 (S32-T290)
      Accession # P28906
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD34; CD34 Antigen; CD34 Molecule; CD34 Sialomucin; Hematopoietic Progenitor Cell Antigen CD34; Hematopoietic Progenital Cell Antigen CD34

  • AA Sequence

    SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT

  • Predicted Molecular Mass

    28.3 kDa

  • Molecular Weight

    Approximately 60-96 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD34 Protein, Human (HEK293, His) Product Image
    1/16
  • CD34 Protein, Human (HEK293, His) Product Image