CD37 Protein, Mouse (HEK293, hFc)
Based on 1 Customer Validation
The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD37 is used at 10 μg/mL can bind Recombinant Mouse CD19. The ED50 for this effect is 4.604 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q61470 (R112-N241)
-
Molecular Construction
-
N-term
-
hFc
-
CD37 (R112-N241)
Accession # Q61470 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD37; Tspan-26; CD37 Molecule; CDNA FLJ25364 Fis, Clone TST01761, Highly Similar To LEUKOCYTE ANTIGEN CD37; TSPAN26; Cell Differentiation Antigen 37; Leukocyte Antigen CD37; Leukocyte Surface Antigen CD37; Tetraspanin-26; Tetraspanin; CD37 Antigen; GP52-4
-
AA Sequence
RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
