CD39L1/ENTPD2 Protein, Human (sf9, His)
CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (sf9, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (sf9, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
CD39L1/ENTPD2 protein, predominantly expressed in the nervous system, plays a pivotal role in the regulation of purinergic neurotransmission by efficiently hydrolyzing ATP and various nucleotides. Notably, CD39L1/ENTPD2 exhibits only marginal hydrolysis of ADP, indicating a substrate specificity that distinguishes it from broader nucleotide hydrolysis. The order of enzymatic activity with different substrates reveals a preference hierarchy, with ATP being hydrolyzed most effectively, followed by GTP, CTP, ITP, and UTP, whereas ADP and UDP show considerably lower hydrolytic efficiency. This nuanced substrate specificity underscores the intricate regulatory role of CD39L1/ENTPD2 in modulating purinergic signaling pathways within the nervous system, emphasizing its contribution to the finely tuned control of neurotransmission through selective nucleotide hydrolysis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q9Y5L3 (T29-D460)
-
Molecular Construction
-
N-term
-
His
-
ENTPD2 (T29-D460)
Accession # Q9Y5L3 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ENTPD2; Ecto-ATPDase 2; Prev. CD39L1; E-NTPDase 2; NTPDase-2; NTPDase 2; Ecto-ATP Diphosphohydrolase 2; CD39-Like-1; CD39 Antigen-Like 1; Ecto-ATPase; Ectonucleoside Triphosphate Diphosphohydrolase 2; Ecto-ATPase 2
-
AA Sequence
TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD
-
Predicted Molecular Mass
49.3 kDa
-
Molecular Weight
Approximately 59 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
