1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CD39L1/ENTPD2 Protein, Human (sf9, His)

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (sf9, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (sf9, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

CD39L1/ENTPD2 protein, predominantly expressed in the nervous system, plays a pivotal role in the regulation of purinergic neurotransmission by efficiently hydrolyzing ATP and various nucleotides. Notably, CD39L1/ENTPD2 exhibits only marginal hydrolysis of ADP, indicating a substrate specificity that distinguishes it from broader nucleotide hydrolysis. The order of enzymatic activity with different substrates reveals a preference hierarchy, with ATP being hydrolyzed most effectively, followed by GTP, CTP, ITP, and UTP, whereas ADP and UDP show considerably lower hydrolytic efficiency. This nuanced substrate specificity underscores the intricate regulatory role of CD39L1/ENTPD2 in modulating purinergic signaling pathways within the nervous system, emphasizing its contribution to the finely tuned control of neurotransmission through selective nucleotide hydrolysis.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

Q9Y5L3 (T29-D460)

Gene ID

954  [NCBI]

Molecular Construction
N-term
His
ENTPD2 (T29-D460)
Accession # Q9Y5L3
C-term
Protein Length

Extracellular Domain

Synonyms
Ectonucleoside triphosphate diphosphohydrolase 2; Entpd2; Cd39l1
AA Sequence

TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD

Predicted Molecular Mass
49.3 kDa
Molecular Weight

Approximately 59 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD39L1/ENTPD2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD39L1/ENTPD2 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD39L1/ENTPD2 Protein, Human (sf9, His)
Cat. No.:
HY-P76903
Quantity:
MCE Japan Authorized Agent: