CD47 Protein, Mouse (HEK293, Tag Free)

The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP伪). CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293, Tag Free) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free. The total length of CD47 Protein, Mouse (HEK293, Tag Free) is 122 a.a., with molecular weight of ~27-34 kDa.

CD47, also known as integrin-associated protein (IAP), is a transmembrane protein encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins and ligands platelet reactive protein-1 (TSP-1) and signal regulatory protein α (SIRPα). CD47 is involved in a variety of biological processes, including signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, and immune regulation. In addition, CD47 is also important in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it prevents immature dendritic cells from maturing and inhibits the production of cytokines by mature dendritic cells. Interaction with SIRPG enhances cell-cell adhesion, T-cell proliferation, and T-cell activation. CD47 positively regulates FAS-dependent T cell apoptosis and inhibits angiogenesis. It may also be involved in metabolic dysregulation during normal aging, regulating wound healing and stem cell self-renewal. CD47 may play a role in cell membrane transport, integrin-dependent signal transduction, and prevention of premature clearance of red blood cells. It interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and fibrinogen. Activation of the CD47 receptor induces the proliferation of human astrocytoma cells through an AKt-dependent pathway. CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD47 at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse SIRP alpha. The ED₅₀ for this effect is 1.14 μg/mL, corresponding to a specific activity is 877.2 Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD47 at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse SIRP alpha. The ED₅₀ for this effect is 1.14 μg/mL, corresponding to a specific activity is 877.2 Unit/mg.

Mouse

HEK293

Tag Free

ADQ12919.1 (Q19-K140)

16423

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

Approximately 27-34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.