CD55/DAF Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, hFc) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, hFc) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD55/DAF Protein plays a crucial role in the immune system by recognizing C4b and C3b fragments generated during C4 and C3 activation. Its interaction with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. This interference serves as a regulatory mechanism, inhibiting complement activation and preventing the formation of C3 and C5 convertases, thereby mitigating complement-induced damage. Notably, CD55/DAF also acts as a receptor for Coxsackievirus A21, as well as coxsackieviruses B1, B3, and B5 during microbial infection, highlighting its diverse roles in immune regulation and viral recognition.
Verified Bioactivity
Measured by its ability to bind human CD97-His in a functional ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P08174 (D35-S353)
-
Molecular Construction
-
N-term
-
DAF (D35-S353)
Accession # P08174 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CD55; CD55 Molecule, Decay Accelerating Factor For Complement (Cromer Blood Group); Prev. DAF; Rh Blood Group D Antigen; CROM; CD55 Antigen; CR; CD55 Antigen, Decay Accelerating Factor For Complement (Cromer Blood Group), Isoform CRA_d; Complement Decay-A
-
AA Sequence
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS
-
Predicted Molecular Mass
61.7 kDa
-
Molecular Weight
Approximately 95-105 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)