CD69 Protein, Mouse (HEK293, His)

CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with C-His labeled tag.

CD69 Protein, a signal transmitting receptor, is involved in lymphocyte proliferation and functions in lymphocytes, natural killer (NK) cells, and platelets. It forms a homodimer through disulfide-linkage.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD69 is coated at 1 µg/mL (100 µL/well) can blind Recombinant Mouse Galectin-1. The ED₅₀ for this effect is 50.65 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD69 is coated at 1 µg/mL (100 µL/well) can blind Recombinant Mouse Galectin-1 .The ED₅₀ for this effect is 50.65 ng/mL.

Mouse

HEK293

C-6*His

P37217 (N62-R199)

12515  [NCBI]

Extracellular Domain

NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR

Approximately 24-32 kDa due to the glycosylation.

• 
  ≥ 85%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.