CD69 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD69 Protein, a signal transmitting receptor, is involved in lymphocyte proliferation and functions in lymphocytes, natural killer (NK) cells, and platelets. It forms a homodimer through disulfide-linkage.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD69 is coated at 1 µg/mL (100 µL/well) can blind Recombinant Mouse Galectin-1. The ED50 for this effect is 50.65 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P37217 (N62-R199)
-
Molecular Construction
-
N-term
-
CD69 (N62-R199)
Accession # P37217 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD69; AIM; CD69 Molecule; EA1; CLEC2C; CDNA FLJ75888, Highly Similar To Homo Sapiens CD69 Antigen (P60, Early T-Cell Activation Antigen) (CD69), MRNA; CD69 Antigen (P60, Early T-Cell Activation Antigen); CDNA FLJ55409, Highly Similar To Early Activation A
-
AA Sequence
NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
-
Molecular Weight
Approximately 24-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
