Copy Link Print Information

FITC-Labeled CD70 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells. As for CD70 protein in human contains transmembrane domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Human (FITC, HEK293, His) is a luorescein isothiocyanate (FITC)-labeled recombinant protein expressed in the HEK293 cells with a N terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 6 months from date of receipt, protect from light. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • FITC-Labeled CD70 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in human contains transmembrane domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Human (FITC, HEK293, His) is a luorescein isothiocyanate (FITC)-labeled recombinant protein expressed in the HEK293 cells with a N terminal His-tag.

Background

CD70 (CD27 Ligand) belongs to the tumor necrosis factor (TNF) family, is the ligand for TNFRSF27/CD27[1].
CD70 and CD27 are homotrimer type II and homodimer type I transmembrane glycoprotein, expressing on activated and resting T and B lymphocytes, respectively[3][4].  As for a wildly use of CD70 in animal disease model, the sequence of amino acids in human is very different from mouse (56.25%) and rat (55.79%).
CD70 as one of the most frequently mutated genes in a series of diffuse large B cell lymphomas, especially acts in a crucial Epstein-Barr virus (EBV)-specific T cell immunity and more generally for the immune surveillance of B cells. CD70 inhibits EBV infection by restoring the expansion of EBV-specific T lymphocytes stimulated by the CD70-deficient EBV-infected B cells[3].
CD70 involves in activation of innate and adaptive immunity, expressing in the mature dendritic cells and being up-regulated upon the triggering of CD40 or Toll-like receptors[2].
CD70 induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation[4].
CD70 is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis[5]. targeting CD70 positive tumors with CAR-T cells induces a potent antitumor response[6].

Verified Bioactivity

Immobilized FITC-Labeled Human CD27 Ligand Trimer, His Tag at 2μg/mL (100μL/well) on the plate. Dose response curve for Human CD27, hFc Tag with the EC50 of 22.7ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession

    P32970-1 (L50-P193)

  • Gene ID
    970  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • CD70 (L50-P193)
      Accession # P32970-1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CD70; Tumor Necrosis Factor Ligand Superfamily Member 7; Prev. CD27LG; Tumor Necrosis Factor Ligand 8A; Prev. TNFSF7; Surface Antigen CD70; CD70 Antigen; Ki-24 Antigen; CD27 Ligand; TNLG8A; CD27-L; LPFS3; CD27L; CD70 Molecule; Tumor Necrosis Factor (Ligan

  • AA Sequence

    LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

  • Predicted Molecular Mass

    51.8 kDa

  • Molecular Weight

    Approximately 63-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 6 months from date of receipt, protect from light. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Bowman MR, et al. The cloning of CD70 and its identification as the ligand for CD27. J Immunol. 1994 Feb 15;152(4):1756-61. [Content Brief]

[2]. Jacobs J, et al. CD70: An emerging target in cancer immunotherapy. Pharmacol Ther. 2015 Nov;155:1-10. [Content Brief]

[3]. Izawa K, et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med. 2017 Jan;214(1):73-89. [Content Brief]

[4]. Brown GR, et al. CD27-CD27 ligand/CD70 interactions enhance alloantigen-induced proliferation and cytolytic activity in CD8+ T lymphocytes. J Immunol. 1995 Apr 15;154(8):3686-95. [Content Brief]

[5]. Kobata T, et al. CD27-CD70 interactions regulate B-cell activation by T cells. Proc Natl Acad Sci U S A. 1995 Nov 21;92(24):11249-53. [Content Brief]

[6]. Jin L, et al. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro Oncol. 2018 Jan 10;20(1):55-65. [Content Brief]

[7]. Boursalian TE, et al. Targeting CD70 for human therapeutic use. Adv Exp Med Biol. 2009;647:108-19. [Content Brief]

[8]. Cormary C, et al. Induction of T-cell antitumor immunity and protection against tumor growth by secretion of soluble human CD70 molecules. Cancer Gene Ther. 2004 Jul;11(7):497-507. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FITC-Labeled CD70 Protein, Human (HEK293, His) Product Image
    1/16
  • FITC-Labeled CD70 Protein, Human (HEK293, His) Product Image