CD70 Trimer Protein, Human (HEK293, His)
CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells. As for CD70 protein in human contains transmembrane domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70Trimer Protein, Human (HEK293, His) is a recombinant protein expressed in the HEK293 cells with a N terminal His-tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in human contains transmembrane domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70Trimer Protein, Human (HEK293, His) is a recombinant protein expressed in the HEK293 cells with a N terminal His-tag.
Background
CD70 (CD27 Ligand) belongs to the tumor necrosis factor (TNF) family, is the ligand for TNFRSF27/CD27[1].
CD70 and CD27 are homotrimer type II and homodimer type I transmembrane glycoprotein, expressing on activated and resting T and B lymphocytes, respectively[3][4].
As for a wildly use of CD70 in animal disease model, the sequence of amino acids in human is very different from mouse (56.25%) and rat (55.79%).
CD70 as one of the most frequently mutated genes in a series of diffuse large B cell lymphomas, especially acts in a crucial Epstein-Barr virus (EBV)-specific T cell immunity and more generally for the immune surveillance of B cells. CD70 inhibits EBV infection by restoring the expansion of EBV-specific T lymphocytes stimulated by the CD70-deficient EBV-infected B cells[3].
CD70 involves in activation of innate and adaptive immunity, expressing in the mature dendritic cells and being up-regulated upon the triggering of CD40 or Toll-like receptors[2].
CD70 induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation[4].
CD70 is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis[5]. targeting CD70 positive tumors with CAR-T cells induces a potent antitumor response[6].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
P32970-1 (L50-P193)
-
Gene ID970
-
Molecular Construction
-
N-term
-
6*His
-
CD70 Trimer (L50-P193)
Accession # P32970-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD70; Tumor Necrosis Factor Ligand Superfamily Member 7; Prev. CD27LG; Tumor Necrosis Factor Ligand 8A; Prev. TNFSF7; Surface Antigen CD70; CD70 Antigen; Ki-24 Antigen; CD27 Ligand; TNLG8A; CD27-L; LPFS3; CD27L; CD70 Molecule; Tumor Necrosis Factor (Ligan
-
AA Sequence
LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
-
Predicted Molecular Mass
51.8 kDa
-
Molecular Weight
Approximately 62-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.;≥ 95%, as determined by HPLC.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)