CD79A Protein, Cynomolgus (HEK293, His)

CD79A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD79A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD79 protein, expressed by HEK293, with C-His tag.

Background

CD79A, in collaboration with CD79B, plays a pivotal role in initiating the signal transduction cascade triggered by antigen binding to the B-cell antigen receptor complex (BCR), resulting in the internalization of the complex, trafficking to late endosomes, and subsequent antigen presentation. This indispensable protein is also crucial for BCR surface expression and the efficient differentiation of pro- and pre-B-cells. CD79A not only stimulates SYK autophosphorylation and activation but also binds to BLNK, facilitating the proximity of BLNK to SYK and enabling the phosphorylation of BLNK. Additionally, it interacts with and enhances the activity of specific Src-family tyrosine kinases, including FYN and LYN. In the context of immature B-cell development, CD79A functions to repress BCR signaling. As a heterodimer of alpha and beta chains, CD79A forms a disulfide-linked complex within the B-cell antigen receptor, where the alpha/beta chain heterodimer non-covalently associates with an antigen-specific membrane-bound surface immunoglobulin composed of two heavy chains and two light chains. The interaction through its phosphorylated ITAM domain with the SH2 domains of SYK stimulates SYK autophosphorylation and activation. Furthermore, when phosphorylated on Tyr-204, CD79A interacts with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and facilitating the phosphorylation of BLNK, a critical step for the trafficking of the BCR to late endosomes. CD79A's versatile interactions contribute to the intricate regulation of B-cell signaling and function.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD79 (L33-R142)
      Accession # XP_045235481.1
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD79A; MB-1; Prev. IGA; CD79A Antigen (Immunoglobulin-Associated Alpha); Ig-Alpha; CD79a Molecule, Immunoglobulin-Associated Alpha; B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain; Surface IgM-Associated Protein; MB1; MB-1 Membrane Glycopro

  • AA Sequence

    LWVDGGPTSLMVSLGEEAHFQCLHNGSNANVTWWRVLHGNYTWPPQFVGKGQGYNGTLTIQNVNKSHGGIYLCRVQEGNKPHQQSCGTYLRVRHPPPRPFLDMGEGTKNR

  • Predicted Molecular Mass

    13.9 kDa

  • Molecular Weight

    Approximately 27-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00