CD79B Protein, Mouse (HEK293, His)
CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-His labeled tag.
Background
The CD79B protein is essential in conjunction with CD79A for initiating the signal transduction cascade triggered by the B-cell antigen receptor complex (BCR). This cascade leads to the internalization of the complex, trafficking it to late endosomes, and facilitating antigen presentation. CD79B enhances the phosphorylation of CD79A, possibly by recruiting kinases that phosphorylate CD79A or by recruiting proteins that bind to CD79A to protect it from dephosphorylation. CD79B forms a disulfide-linked heterodimer with CD79A and is a crucial component of the B-cell antigen receptor complex. In this complex, the alpha/beta chain heterodimer of CD79B and CD79A is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin consisting of two heavy chains and two light chains. CD79B also interacts with LYN.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P15530 (V26-D158)
-
Molecular Construction
-
N-term
-
CD79B (V26-D158)
Accession # P15530 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD79B; CD79b Molecule, Immunoglobulin-Associated Beta; Prev. IGB; B-Cell-Specific Glycoprotein B29; Ig-Beta; B-Cell Antigen Receptor Complex-Associated Protein Beta Chain Isoform 3; B29; CD79b Antigen; B-Cell Antigen Receptor Complex-Associated Protein Be
-
AA Sequence
VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 25-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
