CD8 alpha Protein, Human (HEK293, C-His)
Based on 1 Customer Validation
CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, C-His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, C-His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with C-10*His labeled tag.
Background
CD8 alpha, an integral membrane glycoprotein, plays a pivotal role in orchestrating immune responses against both external and internal threats. In T-cells, it serves as a coreceptor for MHC class I molecule:peptide complexes, facilitating the recognition of antigens derived from cytosolic proteins. Simultaneously interacting with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells (APCs), CD8 alpha recruits the Src kinase LCK to the TCR-CD3 complex, initiating intracellular signaling pathways that culminate in lymphokine production, cellular motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). This mechanism empowers CTLs to identify and eliminate infected or tumor cells. In NK-cells, CD8 alpha homodimers at the cell surface contribute to a survival mechanism, enabling the conjugation and lysis of multiple target cells. Moreover, CD8 alpha homodimers promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. The protein forms disulfide-linked heterodimers with CD8B on the cell surface and homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Interactions with the MHC class I HLA-A/B2M dimer and LCK, as well as its direct interaction with HLA-G, highlight the intricate network of molecular associations that underlie CD8 alpha's diverse functions in immune regulation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD8A at 5 μg/mL can bind Anti-CD8A recombinant antibody. The EC50 is 7.899-27.02 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P01732 (S22-D182)
-
Gene ID925
-
Molecular Construction
-
N-term
-
CD8 alpha (S22-D182)
Accession # P01732 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD8A; Leu2 T-Lymphocyte Antigen; Prev. CD8; T-Cell Antigen Leu2; T-Cell Surface Glycoprotein CD8 Alpha Chain; T Cell Co-Receptor; T-Lymphocyte Differentiation Antigen T8/Leu-2; T8 T-Cell Antigen; CD8alpha; CD8a Antigen; P32; IMD116; CD8 Antigen, Alpha Pol
-
AA Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)