CD8 alpha Protein, Human (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, C-His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, C-His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with C-10*His labeled tag.

Background

CD8 alpha, an integral membrane glycoprotein, plays a pivotal role in orchestrating immune responses against both external and internal threats. In T-cells, it serves as a coreceptor for MHC class I molecule:peptide complexes, facilitating the recognition of antigens derived from cytosolic proteins. Simultaneously interacting with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells (APCs), CD8 alpha recruits the Src kinase LCK to the TCR-CD3 complex, initiating intracellular signaling pathways that culminate in lymphokine production, cellular motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). This mechanism empowers CTLs to identify and eliminate infected or tumor cells. In NK-cells, CD8 alpha homodimers at the cell surface contribute to a survival mechanism, enabling the conjugation and lysis of multiple target cells. Moreover, CD8 alpha homodimers promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. The protein forms disulfide-linked heterodimers with CD8B on the cell surface and homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Interactions with the MHC class I HLA-A/B2M dimer and LCK, as well as its direct interaction with HLA-G, highlight the intricate network of molecular associations that underlie CD8 alpha's diverse functions in immune regulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD8A at 5 μg/mL can bind Anti-CD8A recombinant antibody. The EC50 is 7.899-27.02 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD8 alpha (S22-D182)
      Accession # P01732
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD8A; Leu2 T-Lymphocyte Antigen; Prev. CD8; T-Cell Antigen Leu2; T-Cell Surface Glycoprotein CD8 Alpha Chain; T Cell Co-Receptor; T-Lymphocyte Differentiation Antigen T8/Leu-2; T8 T-Cell Antigen; CD8alpha; CD8a Antigen; P32; IMD116; CD8 Antigen, Alpha Pol

  • AA Sequence

    SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

  • Predicted Molecular Mass

    19 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00