CD81 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.
CD81 is a protein that plays a crucial role in various cellular processes. It is involved in the trafficking and compartmentalization of the CD19 receptor on the surface of activated B cells. This facilitates the assembly of CD19-CR2 and B cell receptor complexes, which lowers the threshold dose of antigen required to trigger B cell clonal expansion and immune response. In T cells, CD81 associates with CD4 or CD8 coreceptors and helps define the maturation state of synapses with B cells. It also facilitates the localization of CD3 in immune synapses, which is necessary for T cell activation and costimulation. CD81 can act as both a positive and negative regulator of cell-cell fusion processes. In myoblasts, it associates with CD9 and PTGFRN to inhibit myotube fusion during muscle regeneration. In macrophages, CD81 prevents fusion into multinucleated giant cells and osteoclasts. It also regulates sperm-egg fusion and may be involved in the acrosome reaction. CD81 is involved in protein trafficking within intracellular compartments and regulates intracellular dNTP levels in T cells. Additionally, it plays a role in integrin-dependent migration of macrophages and is specifically required for the infectivity of Plasmodium yoelii in hepatocytes during malaria infection.
Immobilized Mouse CD81 at 1 μg/mL (100 μL/well) can bind Anti-CD81 Antibody, The ED50 for this effect is 5.548 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-6*His
-
Accession
P35762 (K116-K201)
-
Molecular Construction
-
N-term
-
His
-
CD81 (K116-K201)
Accession # P35762 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD81; CD81 Antigen (Target Of Antiproliferative Antibody 1); Prev. TAPA1; Tspan-28; TSPAN28; TAPA-1; Tetraspanin-28; Target Of The Antiproliferative Antibody 1; CD81 Antigen; Tetraspanin; S5.7; CVID6; CD81 Molecule; 26 KDa Cell Surface Protein TAPA-1
-
AA Sequence
KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
-
Molecular Weight
Approximately 10 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)