CD81 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Background

CD81 is a protein that plays a crucial role in various cellular processes. It is involved in the trafficking and compartmentalization of the CD19 receptor on the surface of activated B cells. This facilitates the assembly of CD19-CR2 and B cell receptor complexes, which lowers the threshold dose of antigen required to trigger B cell clonal expansion and immune response. In T cells, CD81 associates with CD4 or CD8 coreceptors and helps define the maturation state of synapses with B cells. It also facilitates the localization of CD3 in immune synapses, which is necessary for T cell activation and costimulation. CD81 can act as both a positive and negative regulator of cell-cell fusion processes. In myoblasts, it associates with CD9 and PTGFRN to inhibit myotube fusion during muscle regeneration. In macrophages, CD81 prevents fusion into multinucleated giant cells and osteoclasts. It also regulates sperm-egg fusion and may be involved in the acrosome reaction. CD81 is involved in protein trafficking within intracellular compartments and regulates intracellular dNTP levels in T cells. Additionally, it plays a role in integrin-dependent migration of macrophages and is specifically required for the infectivity of Plasmodium yoelii in hepatocytes during malaria infection.

Verified Bioactivity

Immobilized Mouse CD81 at 1 μg/mL (100 μL/well) can bind Anti-CD81 Antibody, The ED50 for this effect is 5.548 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CD81 (K116-K201)
      Accession # P35762
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD81; CD81 Antigen (Target Of Antiproliferative Antibody 1); Prev. TAPA1; Tspan-28; TSPAN28; TAPA-1; Tetraspanin-28; Target Of The Antiproliferative Antibody 1; CD81 Antigen; Tetraspanin; S5.7; CVID6; CD81 Molecule; 26 KDa Cell Surface Protein TAPA-1

  • AA Sequence

    KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

  • Molecular Weight

    Approximately 10 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00