CD84/SLAMF5 Protein, Human (HEK293, His)

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (HEK293, His) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (HEK293, His) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CD84/SLAMF5 protein serves as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, engaging in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of diverse immune cells, contributing to the intricate regulation and interconnection of both innate and adaptive immune responses. The protein's activities are finely tuned by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 can mediate natural killer (NK) cell cytotoxicity, dependent on both SH2D1A and SH2D1B. It enhances proliferative responses of activated T-cells, and SH2D1A/SAP appears not to be required for this process. Homophilic interactions amplify interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A-dependent pathway. The protein may serve as a marker for hematopoietic progenitor cells. Essential for prolonged T-cell:B-cell contact, optimal T follicular helper function, and germinal center formation, CD84/SLAMF5 in germinal centers contributes to maintaining B-cell tolerance and preventing autoimmunity. In mast cells, it negatively regulates high-affinity immunoglobulin epsilon receptor signaling, independently of SH2D1A and SH2D1B but implicating FES and PTPN6/SHP-1. In macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation, modulating LPS-induced cytokine secretion. Additionally, CD84/SLAMF5 positively regulates macroautophagy in primary dendritic cells through the stabilization of IRF8 and inhibits TRIM21-mediated proteasomal degradation of IRF8. The protein forms homodimers via its extracellular domain and interacts with CD48 molecules from other cells in a head-to-tail dimeric arrangement. It also interacts with SH2 domain-containing proteins, including SH2D1A/SAP and SH2D1B/EAT-2, and tyrosine-protein phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 via its phosphorylated cytoplasmic domain, with the latter interaction blocked by SH2D1A. CD84/SLAMF5 further interacts with INPP5D/SHIP1 through its phosphorylated ITSM domains.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD84 (K22-R220)
      Accession # Q9UIB8-1
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CD84; Cell Surface Antigen MAX.3; CD84 Molecule; SLAM Family Member 5; SLAMF5; Hly9-Beta; HCD84; Alternative Protein CD84; MCD84; Leukocyte Antigen CD84; Signaling Lymphocytic Activation Molecule 5; Leucocyte Differentiation Antigen CD84; CD84 Antigen; Le

  • AA Sequence

    KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

  • Predicted Molecular Mass

    23.1 kDa

  • Molecular Weight

    Approximately 35-52 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00