1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Pattern Recognition Receptors
  4. AIM2-like receptors
  5. CD94
  6. CD94 Protein, Human (Biotinylated, HEK293, His-Avi)

CD94 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78097
Handling Instructions Technical Support

CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

CD94 Protein, an immune receptor crucial for self-nonself discrimination, forms a complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and other non-classical MHC class Ib molecules. This interaction enables cytotoxic cells to monitor MHC class I expression in healthy cells, fostering self-tolerance. Primarily serving as a ligand-binding subunit without the capacity to signal, the KLRD1-KLRC1 complex acts as an immune inhibitory receptor, with CD94 playing a key inhibitory role on natural killer (NK) cells. CD94 dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells to prevent autoimmunity. On intraepithelial CD8-positive gamma-delta regulatory T cells, CD94 triggers TGFB1 secretion, limiting the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, CD94 acts as an immune inhibitory checkpoint, potentially contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a state known as cell exhaustion. Upon HLA-E-peptide binding, CD94 transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, ultimately opposing signals from activating receptors by dephosphorylating proximal signaling molecules.

Species

Human

Source

HEK293

Tag

N-Avi;N-8*His

Accession

Q13241-1 (S34-I179)

Gene ID
Molecular Construction
N-term
8*His-Avi
CD94 (S34-I179)
Accession # Q13241-1
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
CD94; KLRD1; KP43; NK cell receptor
AA Sequence

SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Molecular Weight

35-45 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD94 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD94 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD94 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78097
Quantity:
MCE Japan Authorized Agent: